KEGG   Serratia symbiotica: SCc_378Help
Entry
SCc_378           CDS       T01672                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase (IGPS) / N-(5'-phospho-ribosyl)anthranilate isomerase (PRAI)
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
ssz  Serratia symbiotica
Pathway
ssz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ssz01100  Metabolic pathways
ssz01110  Biosynthesis of secondary metabolites
ssz01130  Biosynthesis of antibiotics
ssz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ssz00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCc_378 (trpC)
Enzymes [BR:ssz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SCc_378 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     SCc_378 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AEW44530
UniProt: R4HZT7
Position
818556..819917
Genome map
AA seq 453 aa AA seqDB search
MKETVLENIIADKLQWIVMRQTRQPLASFQYKIIASNRSFYAALQKTKPAFILECKKASP
SKGLIRKNFDPASIALAYKDFAAVISVLTDEKYFQGSVDFLSVVSNTVMQPVLCKDIIID
PYQIYLARLYSADAILLMLSVLNNEQYRQLSDVAHDLNMGILTEVVSEEELERALALGAQ
VIGINNRDLHDLSIDLDRTRQLAMHIPPGITVISESGINQYSQIRKLNQYVNGFLIGSAL
MMENNIRDAICRVILGENKICGLTRPQDAAAAYKAGAIYGGLIFINRSERYISMNHAYKV
IAGAGLKYVGIFCNEHIQTIVDIAECLSLQAIQLHGSEDQVYINNLRHMLPDYCQIWKAL
NVKDRLPSRNIYHIDRFVLDNGAGGTGKCFNWSILQNEDLSNVILAGGLGVNNCMQATKL
GCAGLDFNSGVEIEPGIKDVDRLNTVFQILRSC
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaactgtacttgaaaatattattgctgataagctgcaatggattgttatgcga
cagacgcgacaaccgctagccagttttcaatataaaatcatagcaagtaatcgcagcttt
tatgcggcattgcaaaaaacaaaacctgcatttattttggaatgtaagaaggcttcacct
tctaaaggattaatacgtaaaaacttcgatcccgcgagcatcgcattggcttataaggat
tttgctgcagttatttcagtactcactgacgagaaatacttccaaggtagtgtagatttt
ttatcagtagtgagtaacacagtaatgcagccggtattgtgtaaagatataattattgac
ccataccaaatttatttagcgcgcttatattcggctgacgctattttattaatgctatca
gttctaaataatgaacagtaccgtcagttatcagatgtggcacatgacctcaatatgggg
atattgactgaagttgttagcgaagaagagttagagcgggctcttgccttaggagcgcag
gtcatcggaattaataatcgagatctacatgatttaagtattgatctagatcgtacccgt
caattagcaatgcacataccacctgggataacagtaatcagcgagtccggtattaatcaa
tatagccagatacgtaaactaaatcaatatgtcaatggttttttgattggtagtgcacta
atgatggaaaacaatatacgtgatgctatatgtcgggttattcttggagaaaacaaaatt
tgtggtttaacacgtccccaagatgcagctgctgcttataaagccggtgctatatatggg
ggattaatttttattaatcgctcagaacgttatatctcaatgaaccatgcctataaagtt
attgcaggtgcgggactaaaatacgtaggtatattctgtaatgagcatatacagacgata
gtagatattgctgaatgtcttagtttgcaagcgatacaattacatggctctgaggaccaa
gtttatatcaataacttgcgccacatgttaccagattattgccaaatctggaaagcgcta
aacgtgaaagatcgattaccgtcacgtaatatatatcatatagatcgctttgtactagat
aatggcgctggtggtactggcaaatgtttcaattggtcaattttgcagaatgaagatcta
agtaatgttatactagctggcggcttgggagttaataattgcatgcaggctacaaaactt
ggttgcgccggtttagatttcaactctggagttgaaattgagcctggaattaaagatgta
gatcgtttgaatacggtatttcaaattttgcgttcctgctaa

DBGET integrated database retrieval system