KEGG   Serratia symbiotica: SCc_378Help
Entry
SCc_378           CDS       T01672                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase (IGPS) / N-(5'-phospho-ribosyl)anthranilate isomerase (PRAI)
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
ssz  Serratia symbiotica
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ssz01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:ssz00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
818556..819917
Genome map
AA seq 453 aa AA seqDB search
MKETVLENIIADKLQWIVMRQTRQPLASFQYKIIASNRSFYAALQKTKPAFILECKKASP
SKGLIRKNFDPASIALAYKDFAAVISVLTDEKYFQGSVDFLSVVSNTVMQPVLCKDIIID
PYQIYLARLYSADAILLMLSVLNNEQYRQLSDVAHDLNMGILTEVVSEEELERALALGAQ
VIGINNRDLHDLSIDLDRTRQLAMHIPPGITVISESGINQYSQIRKLNQYVNGFLIGSAL
MMENNIRDAICRVILGENKICGLTRPQDAAAAYKAGAIYGGLIFINRSERYISMNHAYKV
IAGAGLKYVGIFCNEHIQTIVDIAECLSLQAIQLHGSEDQVYINNLRHMLPDYCQIWKAL
NVKDRLPSRNIYHIDRFVLDNGAGGTGKCFNWSILQNEDLSNVILAGGLGVNNCMQATKL
GCAGLDFNSGVEIEPGIKDVDRLNTVFQILRSC
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaactgtacttgaaaatattattgctgataagctgcaatggattgttatgcga
cagacgcgacaaccgctagccagttttcaatataaaatcatagcaagtaatcgcagcttt
tatgcggcattgcaaaaaacaaaacctgcatttattttggaatgtaagaaggcttcacct
tctaaaggattaatacgtaaaaacttcgatcccgcgagcatcgcattggcttataaggat
tttgctgcagttatttcagtactcactgacgagaaatacttccaaggtagtgtagatttt
ttatcagtagtgagtaacacagtaatgcagccggtattgtgtaaagatataattattgac
ccataccaaatttatttagcgcgcttatattcggctgacgctattttattaatgctatca
gttctaaataatgaacagtaccgtcagttatcagatgtggcacatgacctcaatatgggg
atattgactgaagttgttagcgaagaagagttagagcgggctcttgccttaggagcgcag
gtcatcggaattaataatcgagatctacatgatttaagtattgatctagatcgtacccgt
caattagcaatgcacataccacctgggataacagtaatcagcgagtccggtattaatcaa
tatagccagatacgtaaactaaatcaatatgtcaatggttttttgattggtagtgcacta
atgatggaaaacaatatacgtgatgctatatgtcgggttattcttggagaaaacaaaatt
tgtggtttaacacgtccccaagatgcagctgctgcttataaagccggtgctatatatggg
ggattaatttttattaatcgctcagaacgttatatctcaatgaaccatgcctataaagtt
attgcaggtgcgggactaaaatacgtaggtatattctgtaatgagcatatacagacgata
gtagatattgctgaatgtcttagtttgcaagcgatacaattacatggctctgaggaccaa
gtttatatcaataacttgcgccacatgttaccagattattgccaaatctggaaagcgcta
aacgtgaaagatcgattaccgtcacgtaatatatatcatatagatcgctttgtactagat
aatggcgctggtggtactggcaaatgtttcaattggtcaattttgcagaatgaagatcta
agtaatgttatactagctggcggcttgggagttaataattgcatgcaggctacaaaactt
ggttgcgccggtttagatttcaactctggagttgaaattgagcctggaattaaagatgta
gatcgtttgaatacggtatttcaaattttgcgttcctgctaa

DBGET integrated database retrieval system