KEGG   Serratia symbiotica: SCc_379Help
Entry
SCc_379           CDS       T01672                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ssz  Serratia symbiotica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ssz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCc_379 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCc_379 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCc_379 (trpB)
Enzymes [BR:ssz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SCc_379 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
UniProt: 
Position
819955..821145
Genome map
AA seq 396 aa AA seqDB search
MTLLNSYFGEFGGQYVPQILIPALQQLEKVFVSAQRDPEFKAEFIDLLKNYAGRPTALTL
CKNLTTGSKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVAAAT
SCGLLGLKCRIYMGAKDIERQSPNVFRMRLLGAEVLSVHSGSATLKDACNEALRDWSGSY
EKAHYMLGTAAGPHPYPTIVREFQRIIGKETRAQMLEREGCLPNAVLACVGGGSNAIGMF
ADFVNDMGVALIGVEPAGLGIRTGQHGAPLKHGRVGIYFGMKAPMLQTPEGQIKKSYSIS
AGLDFPSVGPEHAYLNNIGRAQYVSITDNEALDAFKMLSCSEGIIPALESSHALAQALKM
IHETPQKEQILVVNLSGRGDKDIFTVHDILKARGDL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgactttgcttaactcttacttcggtgaatttggtggtcaatatgtgccgcaaatctta
ataccggctctgcaacaactggaaaaggtctttgttagtgcccaacgcgatcctgagttt
aaagctgaatttattgatttattaaaaaattacgcaggacgacctacagcactgaccctg
tgtaaaaatctcaccactggtagtaaaacaaaactttacttaaaacgtgaagatctattg
catgggggtgcgcataaaactaaccaggtgcttggtcaagcactacttgcaaaacgaatg
ggtaaaactgagattattgcggaaactggtgcaggtcagcacggcgttgctgcagctaca
tcttgtggattgcttggtctgaagtgccgtatttatatgggagctaaagatattgagcgg
cagtcgccaaatgtatttcgtatgcgtttactcggggctgaggtactctcagtacacagc
ggatccgctactctaaaagacgcttgcaatgaagcactgcgtgattggtctggtagctat
gagaaagcgcattatatgttaggaactgctgcagggccacatccctacccaactatagtg
cgtgaattccaacgtataattggcaaagaaactagagcacagatgctagagcgagaaggt
tgtttaccgaacgcagtattagcctgcgttggtggtggttctaatgctatcggtatgttt
gctgattttgtaaatgatatgggcgtggcgcttatcggtgtagaacccgctgggttaggt
attagaactggtcaacatggtgcgccattaaagcacggccgtgttggcatttattttggt
atgaaggcaccgatgctacaaactccagaaggacaaataaagaagtcttactcaatatca
gccggtttagactttccctctgttggaccagagcatgcttatttaaataatatcggccga
gcacagtacgtatcaattactgataatgaggcactagatgcatttaaaatgctgtcgtgt
agtgaagggattattccagcccttgaatcctctcatgcacttgctcaagcgttaaaaatg
atccatgaaacaccacagaaagagcaaattttagtagttaatttatctggtcgtggtgat
aaggatatatttactgttcatgacatcttgaaagcacgaggagatctttaa

DBGET integrated database retrieval system