KEGG   Serratia symbiotica: SCc_380Help
Entry
SCc_380           CDS       T01672                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ssz  Serratia symbiotica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ssz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCc_380 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCc_380 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SCc_380 (trpA)
Enzymes [BR:ssz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SCc_380 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
UniProt: 
Position
821145..821948
Genome map
AA seq 267 aa AA seqDB search
MDRYQTLFKRLENNKEGAFVPFVMLGDPDQDLSLKIIDTLIESGADALELGIPFSDPLAD
GPEIQGASMRALVTGATPDHSFELLILIRQKYPDIPIGLLVYANLVFNNGIDVFYQRCAN
VDIDSVLIADVPFEESAPFRVDAVRNSIASIFICPPNADDDLLHKISLYGGGYTYLLSRA
GVTGTEIRGQLPRRSLINKLRAYHAPPPLQGFGISDSSQINGALQAGAVGVILGSAIVKI
IRQNQADPVQMLVKLADFVRTMKYATL
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggatcgttatcagacattatttaaacgcttagagaataataaggaaggtgctttcgta
ccatttgttatgctaggtgatcctgatcaagatctatcattaaaaattattgatacgtta
attgaatcgggcgcagatgcactagaactaggtattcctttttctgacccgctcgcagat
ggcccagagattcaaggagcatcaatgcgtgcgcttgttactggcgcaacaccagatcat
agttttgaactattgatattaattcgacaaaaatatccagatattccgattggattatta
gtatatgctaatcttgtattcaataatggtattgatgtattttatcaacgctgcgctaat
gtagatatagactctgtacttattgctgatgtgccttttgaagaatctgcgccattccgt
gttgacgcagtaagaaatagtattgcatcaatctttatatgtccgcctaatgctgatgat
gatttgctgcataaaatttctctctatggaggtggctatacttacttattatcacgtgct
ggcgtgactggtactgaaatacgaggccaattaccaagacgtagccttattaataaacta
cgtgcatatcatgcgcccccaccacttcagggatttgggatctcagattcttctcaaata
aatggcgcattacaggctggtgctgtaggagtgatcctaggttctgcaattgttaagatt
attaggcagaatcaagctgatccagttcagatgttagttaaattggctgattttgtgcgt
acgatgaaatatgctactctataa

DBGET integrated database retrieval system