KEGG   Serratia symbiotica: SCc_418Help
Entry
SCc_418           CDS       T01672                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ssz  Serratia symbiotica
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ssz00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SCc_418 (ispE)
Enzymes [BR:ssz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     SCc_418 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
908528..909391
Genome map
AA seq 287 aa AA seqDB search
MIRIWPAPAKLNLFLYITGQRKDGYHFLQTLFQFLEYSDTLILDPRQDETIRLLTPIDGL
SEEHNIVVRAAHLLQQYCNYHGLLSKTRGVEISINKRLPIGGGLGGGSSNAATVLVALNK
LWHCGLSNNQLAKLGLNLGADVPIFVYGHAAFAEGIGEQLQPANPPEKWYLVAYPGINIP
TSIIFSDAELKRKAPIRCLNELLLAPYVNVCEPIVRKHFIKVEQLISWLLEYAPSRLTGT
GSCVFAEFDTEITARLVLNKAPVWLRGFVARGVNISPLHRILIEQFD
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgattcgcatatggcctgctccagctaagttaaatttattcttatatattaccggtcaa
cgaaaagatggctatcactttttacaaacgctattccaattcttggaatacagtgatact
ttgatattagatccacgtcaagatgaaactattcgtttattaacacctatagatggctta
tcggaagagcataatattgtagtacgtgctgcgcacctactacaacaatattgcaattat
catgggctactcagtaaaactcgtggtgttgaaattagcatcaataaaagattaccaata
ggcggtggtcttggcggtggttcttctaatgctgctactgtactagtggcattaaacaaa
ttgtggcattgtggattaagcaataatcaattagcgaagttagggttaaatcttggtgct
gatgtgcctatttttgtgtatggtcatgcagcttttgcggaaggtattggtgagcaatta
caaccagctaatccaccagaaaaatggtatctagtagcctatcctggaattaatattcct
acttctattattttcagtgatgctgaattaaaacgcaaagctccaattcgctgcttaaat
gagctattattagctccctatgtaaatgtttgtgagccaattgtaagaaaacattttatt
aaagttgaacaacttatttcatggttgctagaatatgctccatcacgcttaactggcaca
ggttcttgtgtttttgcagaatttgacacagaaattactgctagattagtattaaataaa
gctccggtatggttgcgtggttttgtagcgcgtggtgttaatatttctccattacatcga
atccttattgagcaatttgattga

DBGET integrated database retrieval system