KEGG   Serratia symbiotica: SCc_429Help
Entry
SCc_429           CDS       T01672                                 

Gene name
rne
Definition
ribonuclease E
Orthology
K08300  
ribonuclease E [EC:3.1.26.12]
Organism
ssz  Serratia symbiotica
Pathway
RNA degradation
Brite
KEGG Orthology (KO) [BR:ssz00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SCc_429 (rne)
Enzymes [BR:ssz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.12  ribonuclease E
     SCc_429 (rne)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(946367..949462)
Genome map
AA seq 1031 aa AA seqDB search
MKRMLINATQREELRVALVDGQRLYDLDIESSGYEQKKANIYKGKITRIEPSLEAAFVDY
GVERHGFLPLKEIAREYFPSNYSSHGRPNIKDVLCEHQEVIVQIDKEERGNKGAALTTFI
SLAGSYLVLMPNNPRAGGISRRIEGDDRAELKEALASLQLPYGMGLIVRTAGVGKSVDAL
QWDLSFRLKHWEAIKKAAQGRVAPFLIHQESNVIVRAFRDYLRPDIGEILIDNPKILSLA
KEHISALGRPDFSSKIKLYSGDIPLFSHYQIESQIESAFQREVRLPSGGSIVIDSTEALT
AIDINSARATRGSDIEETAFNTNLEAADEIARQLRLRDLGGLIVIDFIDMTPVRHQRDVE
NRLRDVVRQDRARIQIGRISRFGLLEMSRQRLSPSLGESSHHVCTRCNGTGTVRDNESLA
LSILRLIEEEALKENTKEVHAIVPVQVASYLLNEKRDSVSAIEKCQSGVKAIIVPSDQMQ
TPHYSVMRVRKGEETVTLSYLLPKLHEEVKIQPVEDVSTDRKRQESPVLEAVSLDSYDPL
LSTQEPIITTLKAATVNKPNLLSRFFSGLKKLIFTTERSLSIEVTSTKPSLVGNSNENNH
SCRHSRQSSSKKEHVGCRDKHEDYKLRDLIEAPCNDQQKNELVVKKLLSDDTADVAHPML
NEQEHGEKSIEYQRRRQEGKHQFSQGEKLLKGSVIGNNEVLEDKPRTQSMQRRQRRPITQ
NILLFSTEEELDHAAEDLLAPKEIIAKFEDSEHSNITDNIKLLPKIMNAENNAQCDNRSN
NENGMPRRSRRSPRHLRVSGQRRRRYRDERYPVQSPMPLATAFASPELASGKVWISYPVV
QVTQSKETKTHASVNNTAQGSMMTSVDVTVSIINSVIKPQIINVAEVASEQIVASIVQST
TVSMITDEITASKAACVAIPALEPIITNKTSQVKQERLMPAFAISAITEPVLILSQKPKV
KLVPNTPQKHIASAPMTKVPALTYASAEHDQKDWHCRPSFSFTGKGSAGGHAAVNQSMSP
TAKPQPLNDEI
NT seq 3096 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaatgttaattaatgccactcagcgggaagagttgcgtgttgcgcttgtagac
ggacaacggctatatgacttggatatcgagagttcaggttatgaacaaaaaaaagctaat
atttataaaggtaaaatcactcgtattgagccaagtcttgaagcagcatttgtggattac
ggtgtagagcgtcacggctttttaccattgaaagagattgctcgtgaatattttcctagc
aattattcttctcatggtcgtcctaatatcaaagatgtgttgtgcgaacatcaagaagta
atcgttcagatagataaagaagagcgcggcaataaaggcgcggccttaacaacattcatt
agtctagcaggtagttatctagtactcatgccaaataacccacgtgcgggtggtatttcc
cgtcgtattgaaggtgatgaccgtgctgaactaaaagaggcacttgcttctctacagctt
ccgtatggtatggggctcatagttcgcactgcaggtgttggtaagtctgtagatgcttta
caatgggatttatccttccgtttaaagcattgggaagcgattaagaaagctgctcaaggc
agagttgcgccgtttttaattcatcaggaaagtaatgtaattgtaagagcatttcgtgat
tacttgcggccggacattggagagatattaatagataatccaaaaattctcagtttagct
aaagagcatatctcggcgcttggtcgtccggattttagtagtaaaataaagttatatagt
ggtgatattcctttatttagtcactaccaaattgaatcacaaattgaatcagcttttcaa
cgagaagtgcgtctaccctccggtggttcaatagttattgatagtacagaagcattaact
gccattgacattaattctgctcgtgctactcgtggtagtgatattgaagaaactgcattt
aatactaatttggaagcagcggacgaaattgctcgtcaattacgtttacgtgacctcggt
ggattaatcgttattgattttattgatatgacgccagtgcgtcatcaacgtgacgttgaa
aatcgcttgcgtgacgtagtacgccaagatcgtgcacgtattcagattggccgtatttct
cgttttggtttgcttgaaatgtcgcgccaacgccttagtccatcacttggcgaatccagt
catcacgtctgtacgcgctgtaatggtactggcactgtccgtgacaacgaatcattagcc
ctatctattctacgtttaattgaagaagaggctttaaaggaaaatactaaagaagtccat
gctattgtaccggttcaggtcgcttcttatttattaaatgaaaagcgtgattctgtcagt
gcgattgaaaaatgtcagtctggtgtaaaggctattattgttccaagtgaccaaatgcag
acgcctcattactctgtaatgcgtgtgcgtaagggtgaggaaactgtcactcttagttat
ttactgcctaaattacatgaagaggtaaagatacaaccagttgaagatgtatcgactgat
cgcaagcgtcaggagtcgccggtactagaggctgtgtcattagattcttatgacccgtta
ttatctactcaagagcctatcattactacattaaaagctgctactgttaataaaccaaat
ctattaagtcgattttttagtggcttaaaaaagttaatatttactacagagagatcactt
tctatcgaggtaacatctactaaaccttcgctggtaggaaatagtaatgaaaataatcat
tcgtgtcgccacagtcgacaatcttctagtaaaaaagaacatgttgggtgtcgtgataag
cacgaagattataaactacgcgatctcattgaagcgccgtgtaatgatcaacagaaaaat
gaattagttgttaaaaaacttttatcagatgatactgctgatgttgcgcatcccatgctt
aatgagcaagagcacggtgaaaaaagtatagaatatcagcgccgccgtcaagaagggaag
caccagttctctcagggagaaaaattgttgaagggctcagttattggtaataatgaagtg
ctagaagataaacctaggacgcaaagtatgcagcgacgtcaacgacgtccaatcacgcaa
aacatcctgctattctctactgaagaggaattagatcatgccgcagaagatttacttgcg
ccgaaagaaatcatcgctaaatttgaagactctgagcattcaaatataacggataatatt
aaattattacctaaaattatgaatgctgaaaataatgcgcaatgtgataatcgtagtaat
aatgaaaacggtatgccacgtcgctcacgtcgttctccgagacatttacgtgttagtggc
cagcgtcgccggcgttatcgtgatgaacgctaccctgtacaatctcctatgccgttagct
acagcttttgcctcaccagagttagcgtcagggaaagtttggatatcttacccggttgtt
caggtaacacaatcgaaagaaactaaaactcatgctagtgtaaacaatactgctcaaggt
agtatgatgacatcagtagatgttacagtttctatcattaattctgtcattaaaccgcaa
ataattaatgttgcggaagttgcttctgagcaaatagtcgcatctatagtgcagtcaact
acagtttctatgattacagatgaaattacggcttctaaggcagcgtgtgtagcaatacca
gcattagagccaataattactaataaaacatctcaagtaaagcaagaaagactaatgcca
gcgtttgcgatttcagctattacagaacctgtattaatattatcacagaagcctaaagta
aagcttgtgccaaatacaccacaaaaacatattgcaagcgcgccaatgactaaagtgcct
gcactaacttatgcttcagcagaacacgaccaaaaagattggcactgccgcccttctttt
agctttacaggaaaaggctctgctggtggccatgctgcagtaaatcaatctatgtcacca
actgctaaaccgcagccacttaatgatgaaatctag

DBGET integrated database retrieval system