KEGG   Serratia symbiotica: SCc_676Help
Entry
SCc_676           CDS       T01672                                 

Gene name
tpiA
Definition
(GenBank) triose phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ssz  Serratia symbiotica
Pathway
ssz00010  Glycolysis / Gluconeogenesis
ssz00051  Fructose and mannose metabolism
ssz00562  Inositol phosphate metabolism
ssz01100  Metabolic pathways
ssz01110  Biosynthesis of secondary metabolites
ssz01120  Microbial metabolism in diverse environments
ssz01130  Biosynthesis of antibiotics
ssz01200  Carbon metabolism
ssz01230  Biosynthesis of amino acids
Module
ssz_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ssz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCc_676 (tpiA)
   00051 Fructose and mannose metabolism
    SCc_676 (tpiA)
   00562 Inositol phosphate metabolism
    SCc_676 (tpiA)
Enzymes [BR:ssz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SCc_676 (tpiA)
Exosome [BR:ssz04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SCc_676 (tpiA)
  Exosomal proteins of bladder cancer cells
   SCc_676 (tpiA)
  Exosomal proteins of melanoma cells
   SCc_676 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEW44801
UniProt: R4I1M7
Position
1525235..1526002
Genome map
AA seq 255 aa AA seqDB search
MRHPLIMGNWKLHGNTHMVNELVTKLRRQLINVNGCNIAISPPVMYLDQARKILTNTNIA
LGAQNVDINSYGAFTGEISANMLKDIGTKYIIIGHFERRIYHKEKDEIIAKKFAIVKKTG
LIPILCIGETQIESEAGKAEEVYSRQIDAILKTSGVEAMQDAVIAYEPVWAIGTGQCASP
TQAQAAHKFIRNHIAKQDETIANKVIIQYGGSVNDKNAAQLFTQPDIDGALVGGASLQAD
TFTTIVKIAAAVKKF
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcatccattaatcatgggtaactggaagctgcatggtaatactcatatggtcaat
gaactggtcactaagctacgccgtcaattaataaatgttaacggctgcaatattgctatc
tccccaccggtcatgtaccttgatcaagctagaaaaatattaactaacaccaatatcgct
ttaggtgcacaaaatgtagatattaattcgtacggtgcttttactggagaaatttcggca
aatatgctaaaagatatcgggacaaaatacattattataggccactttgagcgccgtatc
tatcataaggaaaaagacgaaataattgctaaaaaatttgcaatagtaaaaaaaacaggt
ctaataccaatactatgcattggtgaaactcaaatagaaagtgaagcaggtaaagctgaa
gaagtatattctcgtcaaattgatgctatactcaaaacctctggagtagaagccatgcaa
gatgctgtaattgcttatgaaccagtatgggccataggtactgggcaatgcgcctcccca
acgcaagctcaggcagcacataaatttatccgtaatcatattgctaaacaagatgaaacg
attgctaataaagttattattcagtacggcggttctgttaatgacaaaaatgcagcccag
ctattcactcaaccagatattgatggcgcgctcgttggtggcgcatcattacaagcagat
acttttactacaattgttaaaattgctgctgccgtcaaaaaattctaa

DBGET integrated database retrieval system