KEGG   Serratia symbiotica: SCc_676Help
Entry
SCc_676           CDS       T01672                                 

Gene name
tpiA
Definition
triose phosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ssz  Serratia symbiotica
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ssz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCc_676 (tpiA)
   01230 Biosynthesis of amino acids
    SCc_676 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCc_676 (tpiA)
   00051 Fructose and mannose metabolism
    SCc_676 (tpiA)
   00562 Inositol phosphate metabolism
    SCc_676 (tpiA)
Enzymes [BR:ssz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SCc_676 (tpiA)
Exosome [BR:ssz04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SCc_676 (tpiA)
  Exosomal proteins of bladder cancer cells
   SCc_676 (tpiA)
  Exosomal proteins of melanoma cells
   SCc_676 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1525235..1526002
Genome map
AA seq 255 aa AA seqDB search
MRHPLIMGNWKLHGNTHMVNELVTKLRRQLINVNGCNIAISPPVMYLDQARKILTNTNIA
LGAQNVDINSYGAFTGEISANMLKDIGTKYIIIGHFERRIYHKEKDEIIAKKFAIVKKTG
LIPILCIGETQIESEAGKAEEVYSRQIDAILKTSGVEAMQDAVIAYEPVWAIGTGQCASP
TQAQAAHKFIRNHIAKQDETIANKVIIQYGGSVNDKNAAQLFTQPDIDGALVGGASLQAD
TFTTIVKIAAAVKKF
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcatccattaatcatgggtaactggaagctgcatggtaatactcatatggtcaat
gaactggtcactaagctacgccgtcaattaataaatgttaacggctgcaatattgctatc
tccccaccggtcatgtaccttgatcaagctagaaaaatattaactaacaccaatatcgct
ttaggtgcacaaaatgtagatattaattcgtacggtgcttttactggagaaatttcggca
aatatgctaaaagatatcgggacaaaatacattattataggccactttgagcgccgtatc
tatcataaggaaaaagacgaaataattgctaaaaaatttgcaatagtaaaaaaaacaggt
ctaataccaatactatgcattggtgaaactcaaatagaaagtgaagcaggtaaagctgaa
gaagtatattctcgtcaaattgatgctatactcaaaacctctggagtagaagccatgcaa
gatgctgtaattgcttatgaaccagtatgggccataggtactgggcaatgcgcctcccca
acgcaagctcaggcagcacataaatttatccgtaatcatattgctaaacaagatgaaacg
attgctaataaagttattattcagtacggcggttctgttaatgacaaaaatgcagcccag
ctattcactcaaccagatattgatggcgcgctcgttggtggcgcatcattacaagcagat
acttttactacaattgttaaaattgctgctgccgtcaaaaaattctaa

DBGET integrated database retrieval system