KEGG   Serratia symbiotica: SCc_678Help
Entry
SCc_678           CDS       T01672                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ssz  Serratia symbiotica
Pathway
ssz00010  Glycolysis / Gluconeogenesis
ssz00030  Pentose phosphate pathway
ssz00051  Fructose and mannose metabolism
ssz00052  Galactose metabolism
ssz00680  Methane metabolism
ssz01100  Metabolic pathways
ssz01110  Biosynthesis of secondary metabolites
ssz01120  Microbial metabolism in diverse environments
ssz01130  Biosynthesis of antibiotics
ssz01200  Carbon metabolism
ssz01230  Biosynthesis of amino acids
ssz03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:ssz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCc_678 (pfkA)
   00030 Pentose phosphate pathway
    SCc_678 (pfkA)
   00051 Fructose and mannose metabolism
    SCc_678 (pfkA)
   00052 Galactose metabolism
    SCc_678 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    SCc_678 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SCc_678 (pfkA)
Enzymes [BR:ssz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SCc_678 (pfkA)
Protein phosphatases and associated proteins [BR:ssz01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SCc_678 (pfkA)
Messenger RNA biogenesis [BR:ssz03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SCc_678 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase VASP_tetra DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AEW44803
UniProt: R4I1X5
Position
complement(1527190..1528215)
Genome map
AA seq 341 aa AA seqDB search
MVYNNIIIKKIAFSIYDVEGVMIKKIGILTSGGDAPGMNAAIRGVVRTALTEGLEVFGIC
DGYFGLYEDRMQKLDRYSVSDIINRGGTILGSARFLQFKDEIFRFKAITNLKKRGIDALV
VIGGDGSYIGAKCLTEEGIPCIGLPGTIDNDVAGTDYTIGYFTALETVVQAIDRLRDTSS
SHQRISIVEVMGRHCGDLTLAAAIAGSCEFIVLPEIKFNRMDLINEIKAEIKKGKNHAIV
AITEHICNINELARHIEQETQRETRATVLGHIQRGGTPVAYDRILASRLGVYAIKLLLQG
YGGRCAGVVNEKMVHHDIIDAIENMKRPFKGELLETAKKLY
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtggtctataacaatataattattaaaaaaattgcatttagcatctatgatgtagaggga
gttatgattaaaaaaataggtatattgacaagtggtggggatgcaccgggtatgaatgcg
gcgattcgtggtgtagtgcgtacagcgcttacagaaggtttagaggtttttggtatttgt
gatggctactttggtttatatgaagatcgcatgcagaaattagatcgttatagcgtatct
gatatcattaaccgcgggggcactattcttggttcagctaggttcctgcaatttaaagac
gaaatatttcgttttaaggcaattacaaacttaaaaaaacgtggcattgatgcgttagtg
gtaattggaggtgatggttcttatataggtgctaaatgtttaacagaagaaggcatacct
tgtatcgggttacctggtaccattgataatgatgtagctggtacagattacactattggg
tattttactgcactagaaactgtagttcaggctattgatcgtttacgcgatacatcctct
tcgcatcagcgaatctctatcgtggaagtgatgggtcgtcactgtggtgatttaacactt
gctgcagcaattgcaggtagctgtgagtttattgtgttaccagaaattaagttcaataga
atggatttaattaatgagattaaggccgagattaagaagggtaaaaatcatgctattgta
gcaatcactgagcatatttgtaatatcaatgagctggctcgtcatattgagcaagaaact
caacgtgagactcgtgcaacggtattgggccacattcaacgtggcggaacacctgttgct
tatgatcgtattttagcatctcgtctaggtgtatatgcaattaaattattattacaaggt
tacggcggtcggtgtgctggtgttgtaaatgaaaaaatggtgcaccatgatattattgat
gcaattgagaatatgaaacgcccatttaaaggtgaattactagaaacagcaaaaaaacta
tattaa

DBGET integrated database retrieval system