KEGG   Spirochaeta thermophila DSM 6192: STHERM_c00510Help
Entry
STHERM_c00510     CDS       T01315                                 

Definition
hypothetical protein
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
sta  Spirochaeta thermophila DSM 6192
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sta00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:sta00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(52311..53585)
Genome map
AA seq 424 aa AA seqDB search
MRYRIEGGFPLKGTILAKGNKNAALPCIAACLLTDEAVVLENVPDIQDVRVMLDIVQYLG
VQVTRLRKDSYRLKTTDIVTSEIPQEKAKLIRASILFAGPLLARTGKAVLSPPGGDVIGR
RRLDTHFLALSALGARVEIDGVFRLTAHRLVGDEIFLDEASVTATENAIMAAVLAEGTTV
IRNAASEPHVQDLCHMLNQMGAQISGIGSNVLTIEGVERLSGTTFAIGSDYMEVGSFIGL
AAVTRGDVVIENADPQHLRMTKLAFGKLGIYWEQEGRTIHVPAGQSLKVVPDLGGAIPKI
DDAPWPGFPADLTSIMTVVATQAEGTILIHEKMFESRMFFVDKLIEMGARIILCDPHRAV
VSGPSRLRGSELTSPDVRAGMAMVIAALCAEGESLIHNVYQIERGYEDLVERLQNLGARI
RKES
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgagataccgaatcgaaggcggtttcccgctcaaaggcaccatcctcgccaaggggaac
aagaacgcagcactcccctgcatcgccgcctgtctcctcaccgacgaagcggtggtcctc
gagaacgtgcccgacatccaggacgtgagggtgatgctcgacatcgtccagtacctcggc
gtccaggtcacgcgccttcgtaaagactcctacaggctcaagaccaccgatatcgtcacc
tcagaaatccctcaagagaaggcgaagctcatccgggcctccatcctcttcgcaggcccc
ctcctggcccgtaccgggaaggcagtactctcaccccccggcggagacgtgatcggtcga
aggaggctcgacacccatttcctcgccctctccgccctgggtgcccgggtggagatcgac
ggcgtcttcaggctcacggcccacagactggtgggggacgagatcttcctggacgaggcc
tcggtgacggccaccgaaaacgccatcatggccgccgtgctcgccgaaggcaccaccgtg
atacggaacgcggcgtccgagccccacgtacaggacctctgccacatgctgaaccagatg
ggagcgcagatctcggggatcggttcgaacgtcctcaccatcgaaggagtggagcgcctc
tcgggtaccaccttcgccatagggtccgactacatggaagtgggttcgttcatcggactc
gcggccgtcacgaggggcgatgtggtcatcgaaaacgcggatccccagcacctcaggatg
accaaactcgccttcgggaagctcgggatctactgggaacaagaggggcgaaccatccac
gtgccggccggacaatccctcaaggtggtgcccgatctgggaggggccatccccaagata
gacgatgccccgtggcccggattcccggccgacctcacgagcatcatgaccgtggtggcc
acccaggccgagggaaccatcctcatccacgagaagatgttcgagtcccgcatgttcttc
gtggacaaactcatcgagatgggcgcacgcatcatactctgcgacccccaccgcgccgtg
gtctcagggccttcacggctccggggctccgaactcacctcgcccgacgtacgggcaggg
atggccatggtgatcgccgccctctgtgcggaaggagagagcctcatccacaacgtctac
cagatagaacgcggatacgaggatctcgtggaacgactccagaacctcggggcccgcatc
aggaaagagtcgtag

DBGET integrated database retrieval system