KEGG   Spirochaeta thermophila DSM 6192: STHERM_c00540Help
Entry
STHERM_c00540     CDS       T01315                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sta  Spirochaeta thermophila DSM 6192
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sta00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    STHERM_c00540 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STHERM_c00540 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    STHERM_c00540 (thrC)
Enzymes [BR:sta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     STHERM_c00540 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
56120..57427
Genome map
AA seq 435 aa AA seqDB search
MRFVSTRNPKDVVSFEEAVFRGLAPDGGLYHPVERLDLAPLYERLGPEKGFVDVSYEMVR
LLFGDEFSEEEAGRLVERAFPFSPVLRELTDSILLLELFHGPSCAFKDFGASFLASCMEV
FLSRREGRAVILTATSGDTGSAVAQAFHGRRHIDVVILYPSGRVSPLQEKQLTTLGGNVH
ALEVAGSFDDCQRMVKEAFLDQELSERCPLTSANSINLGRLVPQSFYYVWAYAQLKARGE
RPFFCVPSGNFGNLTAGVYAWWWGMPVRGFLAATNVNDVVPEYLSTGVFTPRSSVRTLSN
AMDVGNPSNFERLLALFEGDHRRMAAVIRGERVTDEETLDTIARYWRERGVFLDPHTAVG
VKASERLLERERGVAPVVTLATAHPGKFLEVVEEALGIRPPLPPQLEEVLAKEKRAVKIP
NTLEALKSFLLDLWG
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttcgtgagcacgaggaatcccaaggacgtggtctcgttcgaagaggcggtgttc
cgggggcttgctccggacggagggctctaccatccggtggagcgtctggacctcgccccc
ctctacgagcgcctcggtcccgagaagggcttcgtcgacgtctcgtacgagatggttcgc
ctcctcttcggcgatgagttctccgaggaggaggcgggccggctcgtggaacgggccttt
cccttctctcctgtgctgagggagctcaccgattcgatccttctcctcgagctcttccat
gggccttcgtgcgccttcaaggacttcggcgcgagctttctcgcgagctgcatggaggtc
ttcctctcccggagggaggggcgggccgtgatcctcacggccacctcgggggatacgggg
agtgcggtggcacaggccttccacggccggcggcacatcgatgtggtgatcctctaccct
tcggggagggtgagtccgcttcaggagaagcagctcaccacactgggggggaacgtccat
gccctcgaggtggccggctcgttcgacgattgccagcggatggtgaaggaggccttcctc
gatcaggagctcagtgagcggtgtcctctcacgagcgccaattccatcaacctggggagg
ctcgttccgcagtcgttctactacgtgtgggcctatgcccagctgaaggcgcgaggggag
aggcctttcttctgtgtcccgagcgggaacttcggcaatctcaccgccggggtgtatgcg
tggtggtgggggatgccggtgagagggtttctcgcggccaccaatgtgaacgacgtggtg
ccggagtacctttccaccggggtgttcacgccgcggtcgtcggtgaggacgctctcgaat
gccatggatgtgggcaatccgagcaatttcgagcggctcctcgccctcttcgagggagat
caccgccggatggccgcggtgatacggggtgaacgggtgaccgacgaggagacgctcgat
accatcgcccggtactggcgggagcggggggtcttcctcgatcctcacacggcggtgggg
gtgaaggcatcggagcgcctcctggaacgggagaggggggtggcgccggtggtgacgctc
gccacggcgcatccggggaagttcctcgaggtggtcgaggaggcgctggggatcaggcct
cccctccctccccagctggaggaggtgctcgcgaaggagaagcgggccgtgaagatcccc
aacaccctggaggcgctcaagtccttcctcctcgatttgtgggggtag

DBGET integrated database retrieval system