KEGG   Spirochaeta thermophila DSM 6192: STHERM_c01020Help
Entry
STHERM_c01020     CDS       T01315                                 

Definition
(GenBank) hypothetical protein
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sta  Spirochaeta thermophila DSM 6192
Pathway
sta00040  Pentose and glucuronate interconversions
sta00052  Galactose metabolism
sta00500  Starch and sucrose metabolism
sta00520  Amino sugar and nucleotide sugar metabolism
sta01100  Metabolic pathways
sta01130  Biosynthesis of antibiotics
Module
sta_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sta00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    STHERM_c01020
   00052 Galactose metabolism
    STHERM_c01020
   00500 Starch and sucrose metabolism
    STHERM_c01020
   00520 Amino sugar and nucleotide sugar metabolism
    STHERM_c01020
Enzymes [BR:sta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     STHERM_c01020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 LysR_substrate IspD
Motif
Other DBs
NCBI-ProteinID: ADN01078
UniProt: E0RU22
Position
complement(128502..129434)
Genome map
AA seq 310 aa AA seqDB search
MIPFQFSIPISHTHLRPPGPTWYNHIMKGVIVAAGYGTRFLPATKTVPKELLPLVDTPSL
QFIIDEFTASGVDEILVISSRRKKALEDYLDREIELELALERAGKRDLLARIAPPRAHVF
IVHQQEMRGTGHALLCARPFIGDEPFVVAYPDDLHFGNPPLTAQLIRTYRETGCCVLASI
HDPPDLSRYGVLKLAQDGIHVEDMVEKPAPGTEPSREVSIGRYLFTPDVFPLLEEGWKAH
TGGEYYHLYALRRLMAQGKVVHTRVEGKRIDTGEPSGYLEAILEYALTRDDLRVPLERWI
SRHVGFFDGT
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgatccctttccagttttccatccccatttcccacacgcacttgcgtccccccggtcca
acctggtataaccacatcatgaaaggcgtcatcgtcgcggccggctacggcacccgcttc
ctccccgccaccaagaccgtacccaaggaactcctccctctcgtcgacaccccctccctc
cagttcatcatagacgagttcaccgcatccggtgtcgacgagatcctcgtcatctcctcg
cgcaggaagaaggccctcgaggactacctggacagggagatcgagctcgagctcgctctg
gaacgggcagggaagcgggacctcctcgcccgcatcgccccaccccgggcccacgtcttc
atcgtgcaccagcaggagatgaggggcacgggtcacgccctgctctgtgccagacctttc
atcggtgacgagcccttcgtggtggcctatcccgacgacctccacttcgggaacccgccc
ctcaccgctcagctcatccggacctaccgggagacgggctgctgtgtccttgcgagcata
cacgacccgcccgacctctcccgctacggtgtgctcaagctcgcccaagacggcatccac
gtggaggacatggtggagaaacccgcacccggcacggaaccgagtcgcgaggtctccatc
ggaaggtatctcttcacgcccgacgtgttccccctcctcgaagaggggtggaaggcacac
accggaggggaatactaccacctctacgccctgcgccgtctcatggcccaggggaaggtc
gtccacacacgcgtggaagggaaacggatcgacaccggggaaccgtccggctacctcgag
gcgatcctcgagtacgccctcaccagggacgaccttcgggtacccttggaacgatggatc
tcacggcacgtcggattcttcgacgggacatga

DBGET integrated database retrieval system