KEGG   Spirochaeta thermophila DSM 6192: STHERM_c01220Help
Entry
STHERM_c01220     CDS       T01315                                 

Definition
transcriptional regulatory protein
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
sta  Spirochaeta thermophila DSM 6192
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:sta02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:sta02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
154684..155751
Genome map
AA seq 355 aa AA seqDB search
MSEKIRVLVVDDSAIVREVLSRLIGGAPDMELAGTAPDPFIARDKILRTNPDVLTLDIEM
PRLDGLSFLERLMHYRPLPVVVVSSVTTKDSTAVVRALELGAFDVVNKPGDSTSVGEVGE
QILEKIRAAYRYRDQFIGKWRLLKEKGARSGPPAHHLSVVETTEKLVVLGASTGGTVALE
EVLSRLPRGMPPVVVVQHMPPVFTAQFARRLDELCTLRVKEAEDGERLEKGTVYIAPGGY
HLVLERRGEFLYVRLTRDEKVNFQRPSVDVLFESAAEVAGKNTLGVLLTGMGKDGAEGLL
RIKEAGGHTIAQDEASSIVWGMPRVAVEMGAAKEVLPLDRIAERMVKVVSSEGGG
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaagatccgcgtgctggtggtggacgactcggcgatcgtgagggaggtcctc
tcacggctcatagggggggctcctgacatggagctcgcggggaccgccccggatcccttc
atcgcgagggacaagatcctcaggacgaaccccgatgtcctcacccttgacatcgagatg
cctcgtctggacgggctctcgttcctcgagcggctcatgcactaccgccccctcccggtg
gtcgtggtgagctcggtgaccactaaggactcgacggcggtggtgagggctctggagctg
ggggccttcgacgtggtgaacaagccgggggacagtacgagcgtgggggaggtgggtgag
cagatcctcgagaagatccgtgcggcctacaggtacagggatcagttcatcggcaagtgg
cgcctcctcaaggagaagggggcgagatcaggtcctcctgcccaccatctctcggtggtg
gagaccaccgagaagctcgtagtgctgggtgcctccaccggcggcacggtggcgttggag
gaggtgctctcccggctcccgagggggatgccgcctgtggtggtggtgcagcacatgccg
ccggtgttcaccgcccagttcgcgcgacggctggacgagctctgcacgctgcgggtgaag
gaggccgaggatggggagcgtctcgagaagggaacagtgtacatcgcaccgggtgggtac
cacctcgtcctggaacggcggggcgagttcctctacgtgcgtctcacccgggacgagaag
gtgaacttccagcgtccctcggtcgacgtgctcttcgagtctgcggcggaagtggccggg
aagaacacccttggtgtgcttctcaccgggatgggcaaggacggggcggagggactcctg
aggataaaggaggcgggggggcacaccatcgcacaggacgaggcctcttcgatcgtgtgg
gggatgccgagggttgcggtggagatgggggcagcgaaggaggtcctccctctggatcgg
atcgccgagcggatggtgaaggtcgtctcgtcagagggcgggggatga

DBGET integrated database retrieval system