KEGG   Spirochaeta thermophila DSM 6192: STHERM_c01850Help
Entry
STHERM_c01850     CDS       T01315                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sta  Spirochaeta thermophila DSM 6192
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sta01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:sta00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:sta00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
242337..243110
Genome map
AA seq 257 aa AA seqDB search
MSARIMAHMVSFFPDEARSREVAQALVEGGAWALEVQFPFSDPTADGPAIQEACTRALEA
GFTVEKGFRFLEWLKGRWPDLPVFLMCYGSIPVRKGVEAFVARCADLGLEGLIVPDLPPD
YDEGLYGAGARHGVPVVPVVIPQIRGERLSRILSLSPAYVYAALRKGITGYHTEIGEENL
SLLGTLEAAGTRTLAGFGIDSPEQVALLAPHVHAVVVGSAFVRVIASCSGSPAAPLKAKI
RELLCSEEGEPSRVDGI
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcacgcatcatggcccacatggtctcgttcttcccggacgaggcacgttccagg
gaggtggcacaggctctcgtggagggcggtgcctgggccctcgaggtccagttccctttc
tcggatcccacggcagatggaccggccatccaggaggcctgcacgcgggctttggaggcg
ggtttcaccgtggagaaggggttccggttcctcgaatggctgaagggacggtggcccgat
ctcccggtcttcctcatgtgttatgggagtatcccggtgcgaaagggggtagaggcgttt
gtagcccggtgtgcagatctcggactcgagggcctcatcgttcccgaccttcctcctgac
tacgacgaaggcctctacggtgccggagcccgtcatggggtcccggtggtgccggtggtg
attccgcagattcgaggtgaacgactttcccgtatcctctccctttcccctgcctatgtg
tatgcggccctcaggaagggcatcaccgggtatcacaccgagatcggcgaggagaacctc
tccttgctcggcacgctcgaggccgcagggacgaggacgctcgctgggttcggcatcgat
tcgcccgagcaggtggccctcctcgcaccccacgtccacgcggtggtggtgggatcggcg
tttgtccgggtgatcgcctcatgcagcgggagccctgcggctcccctcaaggcgaagata
cgggaactcctctgctcagaggagggggaaccgtcgagagtagacggtatataa

DBGET integrated database retrieval system