KEGG   Spirochaeta thermophila DSM 6192: STHERM_c02570Help
Entry
STHERM_c02570     CDS       T01315                                 

Definition
phosphofruktokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sta  Spirochaeta thermophila DSM 6192
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sta00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    STHERM_c02570
   01230 Biosynthesis of amino acids
    STHERM_c02570
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STHERM_c02570
   00030 Pentose phosphate pathway
    STHERM_c02570
   00051 Fructose and mannose metabolism
    STHERM_c02570
   00052 Galactose metabolism
    STHERM_c02570
  Energy metabolism
   00680 Methane metabolism
    STHERM_c02570
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    STHERM_c02570
Enzymes [BR:sta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     STHERM_c02570
Protein phosphatases and associated proteins [BR:sta01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     STHERM_c02570
Messenger RNA biogenesis [BR:sta03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     STHERM_c02570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
322058..323239
Genome map
AA seq 393 aa AA seqDB search
MKGAALVGQSGGPTSVINASLAGIIEGVRERSGGRIYGMRFGIEGFLEGDLLDLSSLPDQ
EVGLLKATPGSALGSTRRKLTDEDLPRVRELLEKYDIRYLFLIGGNDTMETIHRVEAYCR
RTGYELFGVGVPKTVDNDLVGTDHTPGYPSAARYVALSVLQGGRLAADMQRVDKFAIYQT
VGRDTGWLAAASVVAKRRPDEAPHLICVPERPLTLDRFLADVERAIASYGYCYIVVGEGV
VWEDGTPVSASQEKDSFSNIEFGAMGGASAALTLHRILKDRLGLRGEFQIPESLAMCASD
RVSAIDREEAYACGRKAVTYASEGRSGIMVTIERSSSKPYRFTLGSIPLGEVARKTKPMP
DEFLTPEGHFVSEAFEEYIRPLVGDIERFARLF
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaagggagccgcactcgtgggacagtcgggcgggccgacttcggtgatcaatgcgagt
ctcgccggcatcatcgaaggggtacgggagagatccggaggcaggatctacggcatgagg
ttcgggatcgagggcttcctcgagggggatctcctcgacctctcttccctgccggatcag
gaggtgggacttctcaaggccacgcccggctccgccctggggtccacgagaaggaagctc
actgacgaggatctgccgcgggtgagggagctcctcgaaaagtacgatatccgttacctc
tttctcatcggtgggaatgataccatggagaccatccacagggtcgaggcctactgtcgg
cgtaccggatacgagctcttcggcgtaggtgtgccgaagaccgtggacaacgacctcgtg
ggcaccgatcacacgccggggtatccctccgcggcgcggtacgtcgctctctccgtgctc
cagggggggcgccttgcggccgacatgcagcgtgtggacaagttcgccatctaccaaacc
gtagggcgggatacggggtggctcgcagccgcgagtgtggtggcgaagcggcgtcctgac
gaggcgcctcacctcatctgtgttcccgagcgtcccctcaccctggatcgctttctcgcg
gacgtggagcgcgccattgcatcgtacgggtactgctacatcgtggtgggtgaaggggtg
gtgtgggaggacggcaccccggtctcggcctcgcaggaaaaggacagcttctccaacata
gagttcggcgcgatgggaggagccagtgcagcgttgaccctccatcgcatcctcaaggat
cggctcggtctcaggggcgagtttcagattcccgagtcgctcgcgatgtgtgcgagtgat
cgggtctcggcgatcgacagggaagaggcctatgcctgtgggcgaaaggctgtcacgtat
gcgagcgaagggcgttcggggatcatggtgaccatagagaggagctcttcgaagccgtac
cggttcacgttggggagcattcccctgggggaggtggctcgtaagaccaaacctatgccc
gatgagttcctcactccggagggtcatttcgtgagtgaggcttttgaggagtacatccgc
ccgctggtgggcgatatcgaacgctttgcccgactcttttag

DBGET integrated database retrieval system