KEGG   Spirochaeta thermophila DSM 6192: STHERM_c02670Help
Entry
STHERM_c02670     CDS       T01315                                 

Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sta  Spirochaeta thermophila DSM 6192
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sta00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    STHERM_c02670
   01230 Biosynthesis of amino acids
    STHERM_c02670
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STHERM_c02670
   00030 Pentose phosphate pathway
    STHERM_c02670
   00051 Fructose and mannose metabolism
    STHERM_c02670
   00052 Galactose metabolism
    STHERM_c02670
  Energy metabolism
   00680 Methane metabolism
    STHERM_c02670
Enzymes [BR:sta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     STHERM_c02670
Protein phosphatases and associated proteins [BR:sta01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     STHERM_c02670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
335049..336404
Genome map
AA seq 451 aa AA seqDB search
MQEGGLPAIVTGMEKMSFEIATLGTPKIPSPIGLSTVVGDSIANYVSDEEGVLHRIEVRK
GEQVAADETVVLEKAGPRERLYFDPKHVHAGIVTCGGLCPGLNDVIRSIVRCLWLRYGVR
RISGIQFGYRGLLPEYQYPVIPLDPEVVDDIHKLGGTILGSSRGGGERTEELVDALEQLN
INVLFTIGGDGTQRGALRMAKEIERRGLKIAVVGVPKTIDNDIMYIDKSFGFETAVALAA
QAVSAAHTEAHSAINGIGLVKVMGRESGFIAAHTALAVHEANFVLIPEVPFDLEGENGLL
AHLERRLARRNHAVIIVAEGAGQDLMGPSEERDESGNVKLRDVGAFLKDRIKEHFSRRGI
PINLRYIDPSYMIRSAPACASDSVYCSRLGTNAVHAAMAGKTRLVIGLVNNHFVHLPMEV
VVSQRKRIDPEGSLWRDVLEATQQPLRMKND
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
ttgcaggagggggggctcccggctatagttacaggtatggagaagatgtcgttcgagatt
gccacgctgggtactcccaagatcccttcccccatcggtctttccacggtggtgggggat
tcgatcgccaactatgtgagcgacgaggagggggtcctccaccgaatagaggtgcggaag
ggcgagcaggtggccgcggatgagaccgtggtgctcgagaaggcggggccccgcgagcgg
ctctacttcgatcccaagcacgtgcacgcagggatcgtcacctgcggggggctctgtccg
gggctcaacgatgtgatacggtcgatcgtccggtgtttgtggctccgctacggggtgagg
aggatctccggtatccagttcggctatcgggggctgctccccgagtaccagtacccggtg
atccccctcgatcccgaggtggtggacgatatccacaagctgggaggtacgattctgggt
tcttcccggggcgggggggagcggaccgaggagctggtggatgccctcgagcagctcaac
atcaacgtgctcttcacgatcgggggggacgggacccagcggggggcgttgcggatggcg
aaggagatcgagcgccgggggctcaagatcgcggtggtgggggtgccgaagaccatcgac
aacgacatcatgtacatcgacaagtcgttcgggttcgaaaccgcggtggcgctcgcggcc
caggcggtctcggcggcgcacaccgaggcgcactcggccatcaatgggatagggttggtg
aaggtgatggggagggagtcggggttcatcgcggcgcacacggcgctggcggtgcacgag
gcgaacttcgtgctcatccccgaggtgccgttcgacctcgagggtgagaacggcctgctg
gcccacctggagcggcggctcgcgcgtcgcaaccacgcggtgatcatcgtggcggagggg
gcgggtcaggacctgatgggcccctccgaggagcgggacgagtcggggaacgtgaaactg
cgggacgtcggggcgttcctgaaggatcgcataaaggagcacttctccaggcgcggtatc
cccatcaacctgcgctacatcgatccgagctacatgatccgcagcgcgccggcgtgtgcc
tccgattcggtgtactgctcgaggctggggacgaatgcggtgcacgcggccatggcgggt
aagacgcggctcgtgatcgggctggtgaacaaccacttcgtccacctcccgatggaggtg
gtggtctcccagcggaagaggatcgatcccgaggggagtctgtggcgggatgtgctcgag
gccacgcagcagcctttgcggatgaagaacgactag

DBGET integrated database retrieval system