KEGG   Spirochaeta thermophila DSM 6192: STHERM_c03920Help
Entry
STHERM_c03920     CDS       T01315                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
sta  Spirochaeta thermophila DSM 6192
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sta00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
473084..475213
Genome map
AA seq 709 aa AA seqDB search
MGDPGGRLHYHVCVEERYMQHRILHGAEYNPDQWLEEPEVLEQDIALMREARIDTVTLGT
FSWSLLEPEEGVYSFEWMDEVMERLERAGIRVILATPSGARPRWLARKYPEVLRVGPDRR
RRLFGERHNHCFTSPVFRERVYELDRRLAERYGRREHVILWHISNEFSGECHCELCQEAF
RRWLYDRYDGDLEALNRAWWTAFWSHRYTSWEEIASPSPLGEPNLHGLNLDWRRFVTHQT
VDFMLVEVRALRDGGPSLPVTTNLMGFQRDLDYFRLARHLDVVSWDSYPLWHGRGRTTPR
VACGELDHNWDPEGRDWVLASGVAWAHALHRGLGGGRPFLLMESTPSHTNWQPWSKPKRP
GMHVLSSLHAVAHGADSVQYFQWRAGRGGSEKFHGAVVYHDRRTDGRVFQEVRELGGILE
RLGGMEGSRVEAEVAVVFDWENRWALEDAQGPRNDGRLDYVEECWRWFDAWHRRGVGCDV
VHPEGDWSAYRVVVAPLWYLVKEEWADRVARFVEQGGVFVTTVWSGVVEEHDLCHVGGFP
GPLRGLVGVRSREVDVLVEDEVRRVAGVWGVCEGRLLCDVLAVEDEGVEVRAVYADGFYA
GSPAATRVRRGRGWAYYVGTLLAQEGIDWLVGELMGEAGVVPALRVVPEGVDVSVRVTEE
GRRYLWLLNFREHEVVVELPEGVWRDVLGGGERRGVLVLPGYGYAVLES
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatccgggcgggaggctccactatcacgtgtgtgtggaggaacggtatatgcag
cacaggattcttcatggtgcggagtacaatcccgatcagtggctcgaggagccggaggtc
ctcgagcaggatattgcgctcatgagggaggcgcggatcgatacggtgacgttggggacc
ttttcctggtcgctcctggagcctgaggagggggtctattcgttcgagtggatggacgag
gtgatggagaggctggagagggcggggatcagggtgatcctggcgacgccgtccggggcc
cggcccaggtggctcgcgaggaagtatcctgaggtgctcagggtggggccggacaggagg
cggcgcttgttcggcgagcgccacaaccactgtttcacctcgccggtgttccgggagagg
gtgtacgagctcgacaggaggctcgcggagcgctacggccggagggagcatgtgatcctc
tggcacatctcgaacgagttctcgggtgagtgccactgcgagctgtgtcaggaggccttc
aggcggtggctctacgatcggtatgacggggatctcgaggccctcaatcgggcgtggtgg
acggccttctggagccacaggtacacgagctgggaggagatcgcctctccttcgccgctg
ggcgagcccaatctgcacgggctcaacctcgactggcggcggttcgtgacgcatcagacc
gtggacttcatgctggtggaggtgcgggcgttgagggatggggggccgtccctcccggtg
acgaccaatctcatggggttccagcgggatctcgactacttccggctcgctcggcacctg
gatgtggtctcctgggacagctacccgctctggcatgggcgggggcggacgacgcctcgg
gtggcttgcggggagctcgaccacaactgggatccggagggaagggactgggtgctcgcg
agcggggtggcctgggcccacgcccttcatcgggggctcggcggcgggaggccgtttctc
ctcatggagagtacgccgagccacacgaactggcagccgtggagcaagccgaagcggccg
ggtatgcacgtgctctcctcgctccatgccgtggcgcatggggcggactcggtgcagtac
ttccagtggcgggcggggcggggtggatcggagaagttccacggcgcggtggtgtaccac
gatcggcgtacggacggcagggtgttccaggaggtgagggagctcggggggatcctggag
cggctcggggggatggaggggagccgggtggaggccgaggtggcggtggtgttcgattgg
gagaatcggtgggcgttggaggatgcgcaggggccgaggaacgatgggcggctcgactac
gtggaggagtgttggaggtggttcgatgcgtggcaccggcgtggggtggggtgcgatgtg
gtgcaccctgagggggactggtcggcctaccgagtggtggtggcgccgctgtggtatctg
gtgaaggaggagtgggccgacagggtggcgaggttcgtggagcagggtggggtcttcgtg
acgacggtgtggagcggggtggtggaggagcacgacctgtgccacgtgggcgggtttccg
gggccgttgagggggctggtgggggtgcggagccgggaggtggatgtgctggtggaggac
gaggtgcgccgggtggcgggggtgtggggggtgtgtgaggggaggctgctgtgcgatgtg
ctggcggtggaggatgagggggtggaggtgcgggcggtgtatgcggacgggttctacgcg
ggcagtccggcggcgacgcgggtgaggcgggggagggggtgggcctactacgtggggacc
ctgctcgcccaggagggtatcgactggctggtgggggagctcatgggggaggcgggggtg
gtgccggcgctcagggtggtgcccgagggcgtggatgtctcggtgcgggtgacggaggag
ggaagacggtacctatggcttctcaacttcagggagcacgaggtggtggtggagctcccc
gagggggtgtggagggacgtgctggggggtggggagcggcggggggtcctggtcctgccc
gggtacgggtatgcggtgctggagtcgtga

DBGET integrated database retrieval system