KEGG   Spirochaeta thermophila DSM 6192: STHERM_c03960Help
Entry
STHERM_c03960     CDS       T01315                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
sta  Spirochaeta thermophila DSM 6192
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sta00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sta00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:sta00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
478972..480714
Genome map
AA seq 580 aa AA seqDB search
MRGNLTDEAVGAIKEGIRTKEEQVRLCGLHVQEGRFVHSFEGGSLSFQVERMPLGWVVRG
TVEGRPGRLEVVRLPLRFPLLLQSWESWGACPRVDEGWRFPWGERQYEDWRYTVSLVPEL
MREGVVSDYLAAWEGGLAGFLTSRYAHGFFTVEGEELVGYLEFFDRVFDGPVPLEPLVVL
EGGEIWDLLEVYATMAGRENRARVPAHSPLGWCSWYHYFLDLTWDDVRKNLALAKEWPFE
VFQVDDAYEADIGDWLEPKEGFPPVEEMARTIREAGFTPGIWTAPFCASATSRLFREHPE
WFVKEGGVPLVAFRNWGKDIHALDLSNPEVQAHLSRVFSSLRAAGYGYFKIDFLFAGAVP
GERVMAVSPVEAYRMGLETIRAAVGDAFILGCGAPLLPSVGLVDGMRIGPDTTPFWDPAV
PDNGAPAIQYALRNALYRSFMHRRFWLNDPDCLLLRKDRISLTEEERRTFALTAGALDGM
LVVSDDLSLVDAAGRGLLDEALSLTGGRPRVGDLGGGCYEVVSEGTRSGRVRLVVNLGEE
EAGGVAPHGVVLEKEEQGLGLSRRVELREGRRFTYYHREE
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgcggggaaacttgacagatgaggccgtgggtgcgataaaggaggggatccgtaccaag
gaggaacaggtgaggctgtgtggactgcacgtgcaggaagggcgtttcgtccattccttc
gaaggaggttctctctcgttccaggtggaacgcatgcccctcggctgggtggtgcgcggg
accgtggaggggaggccgggccggctcgaggtggtgcgtctgccgctccggttccccctc
ctgctccagtcgtgggagtcgtggggggcgtgccctcgggtggatgaggggtggcggttc
ccctggggcgagcggcagtacgaggactggcgctacaccgtctcgctcgtgcccgagctg
atgcgggagggcgtggtgagcgactacctggccgcatgggagggagggctcgcggggttt
ctcacctcccggtatgctcacgggttcttcaccgtggagggggaggaactggtgggctac
ctggagttcttcgatcgggtcttcgatgggcccgtacccctggagcccctcgtggtgctg
gagggtggggagatctgggacctcctcgaggtgtacgcgaccatggcggggagggagaat
cgggcgcgggtgcctgcgcactcgcctctcgggtggtgcagctggtaccattacttcctc
gacctcacctgggatgatgttcggaagaacctcgccctcgcgaaggagtggccgttcgag
gtgttccaggtggacgatgcctacgaggcggatatcggtgactggctcgagccgaaggag
gggtttcctccggtggaggagatggcccgcaccatacgggaggccggcttcacccccggg
atctggaccgcgccgttctgcgcctctgcgacctcgcgtctgttcagagagcatcccgag
tggttcgtgaaggaagggggggtgccgctcgtggccttcaggaactggggcaaggacatc
catgccctcgacctctcgaatcctgaggtgcaggcgcatctctcgagggtcttctcctcg
ctcagggctgcggggtacgggtacttcaagatagactttctcttcgcgggggcggtgccg
ggggagcgggtgatggccgtaagcccggtggaggcctatcggatggggctcgagactatc
cgtgctgcggtaggggatgccttcatcctcggatgtggtgccccactcctcccctctgta
gggttggtggatgggatgcggatcggtccggacaccacccccttctgggatccggccgtg
cctgacaacggcgctcctgctatccagtatgccctccggaatgcgctctaccgctcattc
atgcaccgtcgcttctggctcaacgatcccgactgtctcctcctgaggaaggaccggatc
tcgctcaccgaggaggagcggcggaccttcgccctcaccgcgggggccctcgacgggatg
ctcgtggtgagtgacgacctctctctggtggatgcggcggggaggggactcctcgatgag
gccctctccctcacgggggggcggccgagggtgggggacctcggagggggctgctacgag
gtggtctcggaggggacgaggagcgggagggtgcgcctcgtggtgaacctgggggaggag
gaggcaggaggagtggcgcctcacggtgtggtgctggagaaggaggagcagggtctcggg
ctttcccgcagggtggagcttcgggagggtcggaggttcacgtactaccacagggaggag
tag

DBGET integrated database retrieval system