KEGG   Spirochaeta thermophila DSM 6192: STHERM_c06370Help
Entry
STHERM_c06370     CDS       T01315                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sta  Spirochaeta thermophila DSM 6192
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sta00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    STHERM_c06370
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STHERM_c06370
   00052 Galactose metabolism
    STHERM_c06370
   00500 Starch and sucrose metabolism
    STHERM_c06370
   00520 Amino sugar and nucleotide sugar metabolism
    STHERM_c06370
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    STHERM_c06370
   00524 Butirosin and neomycin biosynthesis
    STHERM_c06370
Enzymes [BR:sta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     STHERM_c06370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(718398..719471)
Genome map
AA seq 357 aa AA seqDB search
MKREWFSQHPPAGAVLLAADIGGTNTNIALFEQQGGRLAMLAHWEFASRELANLEEALSQ
VIEDLQETLGTGIHIHGLCASGAGPVEENVCHLTNLPWIIDGEAIHRDLGVKTVVINDFS
AICYGVPILESQAEEKLVPIPHTDGRIPPRRGVVRAVIGAGTGLGVGFLVEDRGEFHAYP
SEGGHIDFPADDEGGDALRRYLASRYAPTPDAEAVVSGQGIANIFAFLVETGRIEQDETT
RTILSHPPEDRPPLIARHRSSHEGCRRTMELFARLYGHIAAAFALTFLPTAGLYLAGGIA
AKNLPLFLESPAFMEAFEANCRPNIRAVLSRIPVYIITDYSISLYGAAYAAGILIHD
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaagagagaatggttttcgcaacacccgcctgcaggggccgtgcttctcgcggccgac
atcggaggaaccaacaccaacatcgccctcttcgaacaacagggcgggcgactcgccatg
ctcgcccactgggagttcgcgagcagggaactcgcgaacctggaggaagccctctcgcag
gtgatagaggacctccaggagactctcgggacagggatccacatccacgggttgtgcgca
tccggcgcaggaccggtggaggagaacgtgtgtcacctcacgaacctcccctggatcatc
gacggcgaggccatacatagggatcttggggtgaagacggtggtcatcaacgatttctcg
gccatctgctacggggtacccatcctggagagccaggccgaggagaagctcgtgcccata
ccccacaccgacggacgcatccccccgaggaggggggtggtgcgggcggtgatcggagcc
gggaccgggctcggcgtgggcttcctcgtggaggacaggggggagttccacgcctatccc
tccgagggggggcacatcgactttccggccgatgatgaaggcggggatgcgctccggcgc
tacctcgcctcccgctacgcccccacgcccgatgccgaggcagtggtctcgggacagggg
attgccaacatcttcgccttcctggtggagacaggccggatcgagcaagacgagaccacc
cgcaccatcctctcccacccccctgaagaccgcccccccctcatcgcccgacaccgcagc
tcgcacgaggggtgccgccgcaccatggagctcttcgcccgcctctacgggcacatcgcc
gcggccttcgccctcaccttcctgcccaccgccgggctctacctcgcgggcgggatcgcg
gcgaagaacctccccctcttcctggagagccctgccttcatggaggccttcgaggcgaac
tgcagacccaacatccgggcggtgctctcccgcatcccggtgtacatcatcaccgactac
agcatctcgctctacggtgcagcctacgccgcggggatcctcatccatgactga

DBGET integrated database retrieval system