KEGG   Spirochaeta thermophila DSM 6192: STHERM_c07030Help
Entry
STHERM_c07030     CDS       T01315                                 

Definition
hypothetical protein
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
sta  Spirochaeta thermophila DSM 6192
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sta00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    STHERM_c07030
Enzymes [BR:sta01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     STHERM_c07030
    3.5.1.-  
     STHERM_c07030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(784962..785570)
Genome map
AA seq 202 aa AA seqDB search
MRALIVVDVQNDFVPGGALPVPEGDAVIPVINRLMGRFDVVVATQDWHPATHKSFASNHP
GRRPYEVITLEGLEQVLWPDHCVQGSPGAEFAPGLDLRPVEAIVRKGTDPGIDSYSGFYD
NGRKRTTGLAGYLRERGVREVYVTGLAGEYCVFYTAMDAAAEGFATFVVEDATRPLDQED
FEKAVVRMREQGITILRSGNVR
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgagagcgctcatcgtcgtggacgtccagaacgatttcgtcccgggaggggcccttccg
gtgccggaaggcgatgccgtcatcccggtgatcaaccgcctcatgggccggttcgacgtg
gtggtggccacccaggactggcaccctgccacacacaagagcttcgcatcgaatcatccg
gggaggaggccctacgaggtgatcaccctcgagggactcgagcaggtgctctggcccgat
cactgcgtgcagggatccccgggcgcggagttcgcacccgggctcgacctccgtcccgtg
gaggcgatcgtccgcaaggggacggatcccgggatcgacagctatagcgggttctacgac
aacggccggaagcggaccacggggctcgccgggtacctgcgggagcggggggtgagggag
gtgtacgtgacggggctcgccggcgagtactgcgtcttctacacggccatggatgcggcc
gccgagggattcgccaccttcgtggtggaggacgctacgaggcccctcgatcaggaggac
ttcgaaaaggcggtggtccgcatgagggaacaggggatcaccatcctacggtcggggaac
gtacgctga

DBGET integrated database retrieval system