KEGG   Spirochaeta thermophila DSM 6192: STHERM_c07580Help
Entry
STHERM_c07580     CDS       T01315                                 

Definition
hypothetical protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sta  Spirochaeta thermophila DSM 6192
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sta00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:sta00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(845189..846871)
Genome map
AA seq 560 aa AA seqDB search
MSRGGHAPLLSLLLLPWMLPAGPASFWDLTEEEIPSFLEAMSDEETISQVFLIGYEGETP
DPRILQWIERYNLGGIKIFGRNAERLLPVVRSVAAYQEKALAHRSGIPLLVATDQEGGWV
RHIKGETVETPGNMAIGATRLPYEAYQTGLLIGKELRALGITMNFAPTVDVYVNPEAHVI
GPRSFGSDPRLVATLALSFYHGSLDAGVIPVAKHFPGHGNARGDSHGELPVVEDDLATLW
ERDWLPYRILIREGLPAVMVGHLNFPLLSKNDLPATLSPRVISLLREKLGFQGLVITDDL
YMMGARVAGEDIPHIVVEALSAGNDMVLLSRPPHPGDPVWEAVLSRYRNDPEFRKRIQTS
VRRIITLKIRYLKAMGPKGLIPSEETLREVFPDEETAEAFGEQALRAVTMIRNGKVPLSP
GGDARVLLVGQHTRFLSIGKEYFPRADTFQFSYLPFYFASEQVKTRLSRLVQQYDLVIYC
LMNPNSLEVLASLEEWAPRIAVLSTLTPVYLAEVPWVDTAVAIYGTSEECYRGGFLALMG
KLTPAGTLPISLTPPSGAPP
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgagtagagggggacacgcccccctactttcccttctcctcctcccatggatgctgccg
gccggtcccgcttcgttctgggacctcacggaggaggagatcccttccttcctcgaagcc
atgtccgacgaggagacgatcagccaggtcttcctcatagggtacgagggcgagaccccc
gacccccggatcctgcagtggatcgagcgctacaacctgggcggcatcaagatcttcggg
aggaacgccgagcgcctcctcccggtggtgaggagtgtggcggcctaccaggaaaaggcg
ctcgctcaccgttccggcatccccctcctcgtcgccaccgaccaggagggcggatgggtc
cgccacataaagggggagaccgtagagactcccgggaacatggccatcggcgcgacccgc
ctcccctacgaggcctatcagaccggcctcctcatcggaaaggaattgagggccctgggg
atcaccatgaacttcgcccccacggtggacgtgtacgtcaatcccgaagcccacgtgata
gggcccagatcctttggatcggatccccggctggtcgccacgcttgcgctctccttctac
catgggagcctggacgccggggtgatcccggtggccaaacacttcccgggacacgggaac
gcccgcggggactcccacggcgagctccccgtggtggaagacgacctggccaccctctgg
gagagggactggctcccctatcggatcctcatcagggaggggttgcccgccgtcatggta
ggacacctcaactttcctcttctctccaaaaacgacctgcccgccaccctctccccccgc
gtgatctctctcctcagggagaaactcggcttccagggactcgtcatcacggacgacctc
tacatgatgggggcccgcgtcgcgggggaggacatcccacatatcgtggtagaggctctc
tcggccggcaacgacatggtcctcttgtcgaggcctccccatccgggagacccggtctgg
gaggccgtgctgtcgagatatcggaacgatcccgagttcaggaaacgaatacagacctcc
gtgaggaggatcatcacgctcaagatccgatatctgaaggccatggggccaaaaggcctc
atcccctccgaggagaccctgcgggaggtcttccccgacgaggaaaccgcggaggcgttc
ggggaacaggccctcagggccgtcaccatgatacgaaacgggaaggtgccgctctcccct
ggaggcgatgcacgcgtactcctcgtggggcaacacaccaggttcctctccatcgggaag
gaatacttcccccgcgcggacaccttccagttttcctatctccccttctattttgcctcc
gaacaggtgaagactcgactctcccgtctcgtccagcagtatgatctggtcatctactgt
ctcatgaaccccaacagtctcgaggtcctcgcctcgctcgaagaatgggcgccacgaatc
gcggtgctctccaccctcacaccggtgtacctcgccgaggtcccctgggtggacacagcg
gtggccatatacggcacgagcgaggagtgttaccggggtggcttcctcgccctcatgggc
aaactcacccccgccgggacactccccatctccctcacccccccctccggagcacctccc
tga

DBGET integrated database retrieval system