KEGG   Spirochaeta thermophila DSM 6192: STHERM_c08180Help
Entry
STHERM_c08180     CDS       T01315                                 

Definition
hydrolytic enzyme
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
sta  Spirochaeta thermophila DSM 6192
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sta00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    STHERM_c08180
  Lipid metabolism
   00561 Glycerolipid metabolism
    STHERM_c08180
   00600 Sphingolipid metabolism
    STHERM_c08180
Enzymes [BR:sta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     STHERM_c08180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(901840..903222)
Genome map
AA seq 460 aa AA seqDB search
MSHIPQSLDIAYIGGGSRGWAWKLMADLALEPALTGRVRLYDIDQEAARLNERIGNRLSA
RPDVKGKWRYEVRTSLKEALEGVDVVIISIMPGTFKEMEVDVHAPEAFGIYQSVGDTTGP
GGLFRALRTIPLYEEFAQAIETWAPAAWVINYTNPMAICVRTLYEVFPGVKAFGCCHEVF
GTQELLASMAAHEGLVQDPPHRREIHINVLGLNHCTWIDRASFRDVDLLPMYRRFAERHR
EEGFETGGERTWENDYFTSAHKVKFDLFLRFGLIAAAGDRHLAEFFPASWYLKDPETVRS
WKFSLTPVSWRVENQKSLEARARRLASGEEEVELAASGEEGVLMLKAIAGVEETVSNVNL
PNRGQIANLPPDTVVETNALFRYDSVQPVQAGALPSSLLAFLASHAAQQETILRAGLQRD
PELAFRAFCADPLAAHLSPSEAERLFSLMLERLTPSMPGW
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgagtcacataccgcaatcgctcgacatcgcctacataggagggggatcacgcgggtgg
gcgtggaagctcatggcggatctcgcactcgaacccgccctcaccgggagggtccgcctc
tacgacatcgatcaggaggcggcgcgcctcaacgaacggatcggcaaccgactctccgcc
cggcccgatgtgaaggggaagtggcgctacgaggtcaggacgagcctcaaggaggcgctc
gagggtgtggatgtggtgatcatctccatcatgcccggcaccttcaaggagatggaggtg
gatgtccatgcgcccgaggccttcgggatctaccagtcggtgggtgacaccacgggaccg
ggcggcctgttcagggccctgaggaccattcccctctacgaggaattcgcacaggccatc
gagacatgggcgccggcggcatgggtgatcaactacaccaatcccatggcgatctgcgtc
aggaccctctacgaggtctttccgggggtgaaggccttcggatgctgtcatgaggtcttc
gggacccaggagctcctcgcctcgatggcggcccacgaggggctcgtccaggatcctccg
caccggagggagatccacatcaatgtcctggggctgaaccactgtacgtggatcgacagg
gcttcgttccgggacgtggatctcctcccgatgtaccggcgcttcgcggagcgtcacagg
gaggaggggttcgagacagggggcgaacgcacctgggagaacgactacttcacgagcgcc
cacaaggtgaagttcgacctcttcctgcggttcggactcatcgcggcggcaggggacagg
cacctcgcggagttcttccccgcatcctggtacctgaaggaccccgagaccgtgcgctcc
tggaagttcagtctcaccccggtctcctggcgggttgagaatcagaagtcgctcgaggcg
cgggcgcggaggctcgcctccggcgaggaagaggtagagctcgcagcctcgggagaggaa
ggggtcctcatgctgaaggccatcgcaggggtggaggagacggtgagcaacgtgaacctt
cccaaccgaggacagatcgccaatctcccgccggacacggtggtggagaccaacgccctc
ttcaggtacgactcggtccagcccgtccaggccggggcccttccctcctccctcctggcc
ttcctcgcctcccatgcagcccagcaggagaccatcctcagggccggtctccaacgagat
cccgaactcgccttcagggccttctgcgcagacccgctcgcggcacacctctccccgagc
gaggccgagaggctcttctcactcatgctcgagcggctcacaccctcgatgcccggctgg
tga

DBGET integrated database retrieval system