KEGG   Spirochaeta thermophila DSM 6192: STHERM_c08240Help
Entry
STHERM_c08240     CDS       T01315                                 

Definition
(GenBank) hypothetical protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sta  Spirochaeta thermophila DSM 6192
Pathway
sta00010  Glycolysis / Gluconeogenesis
sta00020  Citrate cycle (TCA cycle)
sta00620  Pyruvate metabolism
sta01100  Metabolic pathways
sta01110  Biosynthesis of secondary metabolites
sta01120  Microbial metabolism in diverse environments
sta01130  Biosynthesis of antibiotics
sta01200  Carbon metabolism
Module
sta_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sta00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STHERM_c08240
   00020 Citrate cycle (TCA cycle)
    STHERM_c08240
   00620 Pyruvate metabolism
    STHERM_c08240
Enzymes [BR:sta01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     STHERM_c08240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 QRPTase_N
Motif
Other DBs
NCBI-ProteinID: ADN01773
UniProt: E0RRY6
Position
908460..909710
Genome map
AA seq 416 aa AA seqDB search
MAHEVVMPRFGSTVESAVIVEWKVKEGDTVAEDTVLCEVETDKATFEVRAGKSGTVLRLL
HAEGEDVPVLSPLALIGEPGEEISSEAVPQEGPSREEAPEDRAPEPQERSSVPSRGEGRE
AGRIYASPRARRLAEKEGVDLSGMRGSGPRGRIMERDVRAVIERRGRGVAPEGGDVRPRP
AETGVQGRPLSGIRRVIAQRMRESLSQTAQYTITMRAPARALLSFRRRCKESGDPELSSI
TINDLILYAVSRALLPDYPMLNAHYDGTSLVLHPSVHLGVAVDTERGLVVPVVRDAASLS
LLELSKRVKELSRAALRGDLDPDLMKGSTFTVTNLGPLGVETFTPVLNYPEVAILGVGGI
VPTPVYRDGDMEEVVHEPRLVLSLTCDHQVVDGAPAARFLKHLCGVIADIDLWLAR
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggctcatgaagtggtgatgccgagattcggaagcaccgtggaatcggcggtgatcgtg
gagtggaaggtgaaagagggggatacggtcgccgaagacacggtactctgcgaggtcgag
acggacaaggccaccttcgaggtgcgtgcgggcaagtccgggacggtgctccgcctcctc
cacgccgagggggaagacgtgccggtgctttcacccctcgccctcataggagaacccggg
gaggagatctcctccgaggccgttccccaagaggggccgtcccgtgaggaggcgcccgaa
gaccgggctccggaaccgcaggagaggtcctccgtcccgtcccggggggaggggagggag
gcgggtcgcatctatgcgagccctcgggcccgccgtctcgccgagaaggaaggggtggat
ctctcggggatgagggggtcggggccgagaggacggatcatggagcgggacgtgagggcg
gtgatcgaacggaggggaaggggggtggctcccgaggggggcgacgtgcggccccggccg
gcggagacgggtgtgcaaggccgtcccctctcggggatacgccgggtcatcgcacagcgg
atgcgggagtcgctctcccagacggcccagtacaccatcaccatgcgggcccctgcccgg
gccctcctctcgttccggaggcggtgcaaggagtcgggggacccggagctttcgtccatc
accatcaacgatctcatcctctacgccgtctcgagggccctcctgccggactatcccatg
ctcaacgcccactacgacggtacgtccctcgtccttcatccctctgtccatctcggggtg
gcggtggataccgagcgggggctcgtggtcccggtggtgcgtgatgccgcctcgctctcc
ctgttggagctctccaagagggtgaaggagctctcccgggcggccctgaggggtgatctc
gatcccgatctcatgaaggggtccaccttcacggtcaccaacctcggcccgctgggggtc
gagaccttcactcccgtgctcaactatcccgaggtcgccatcctgggggtgggcggcatc
gtgcccacgccggtgtatcgggacggggatatggaggaggtggtccatgaacctcgactc
gtactgagcctcacgtgtgaccaccaggtggtggacggcgcgcccgccgcgcgcttcctg
aaacacctgtgcggggtcatagccgacatagatctgtggctcgcccggtga

DBGET integrated database retrieval system