KEGG   Spirochaeta thermophila DSM 6192: STHERM_c08240Help
Entry
STHERM_c08240     CDS       T01315                                 

Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sta  Spirochaeta thermophila DSM 6192
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sta00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    STHERM_c08240
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STHERM_c08240
   00020 Citrate cycle (TCA cycle)
    STHERM_c08240
   00620 Pyruvate metabolism
    STHERM_c08240
Enzymes [BR:sta01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     STHERM_c08240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
908460..909710
Genome map
AA seq 416 aa AA seqDB search
MAHEVVMPRFGSTVESAVIVEWKVKEGDTVAEDTVLCEVETDKATFEVRAGKSGTVLRLL
HAEGEDVPVLSPLALIGEPGEEISSEAVPQEGPSREEAPEDRAPEPQERSSVPSRGEGRE
AGRIYASPRARRLAEKEGVDLSGMRGSGPRGRIMERDVRAVIERRGRGVAPEGGDVRPRP
AETGVQGRPLSGIRRVIAQRMRESLSQTAQYTITMRAPARALLSFRRRCKESGDPELSSI
TINDLILYAVSRALLPDYPMLNAHYDGTSLVLHPSVHLGVAVDTERGLVVPVVRDAASLS
LLELSKRVKELSRAALRGDLDPDLMKGSTFTVTNLGPLGVETFTPVLNYPEVAILGVGGI
VPTPVYRDGDMEEVVHEPRLVLSLTCDHQVVDGAPAARFLKHLCGVIADIDLWLAR
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggctcatgaagtggtgatgccgagattcggaagcaccgtggaatcggcggtgatcgtg
gagtggaaggtgaaagagggggatacggtcgccgaagacacggtactctgcgaggtcgag
acggacaaggccaccttcgaggtgcgtgcgggcaagtccgggacggtgctccgcctcctc
cacgccgagggggaagacgtgccggtgctttcacccctcgccctcataggagaacccggg
gaggagatctcctccgaggccgttccccaagaggggccgtcccgtgaggaggcgcccgaa
gaccgggctccggaaccgcaggagaggtcctccgtcccgtcccggggggaggggagggag
gcgggtcgcatctatgcgagccctcgggcccgccgtctcgccgagaaggaaggggtggat
ctctcggggatgagggggtcggggccgagaggacggatcatggagcgggacgtgagggcg
gtgatcgaacggaggggaaggggggtggctcccgaggggggcgacgtgcggccccggccg
gcggagacgggtgtgcaaggccgtcccctctcggggatacgccgggtcatcgcacagcgg
atgcgggagtcgctctcccagacggcccagtacaccatcaccatgcgggcccctgcccgg
gccctcctctcgttccggaggcggtgcaaggagtcgggggacccggagctttcgtccatc
accatcaacgatctcatcctctacgccgtctcgagggccctcctgccggactatcccatg
ctcaacgcccactacgacggtacgtccctcgtccttcatccctctgtccatctcggggtg
gcggtggataccgagcgggggctcgtggtcccggtggtgcgtgatgccgcctcgctctcc
ctgttggagctctccaagagggtgaaggagctctcccgggcggccctgaggggtgatctc
gatcccgatctcatgaaggggtccaccttcacggtcaccaacctcggcccgctgggggtc
gagaccttcactcccgtgctcaactatcccgaggtcgccatcctgggggtgggcggcatc
gtgcccacgccggtgtatcgggacggggatatggaggaggtggtccatgaacctcgactc
gtactgagcctcacgtgtgaccaccaggtggtggacggcgcgcccgccgcgcgcttcctg
aaacacctgtgcggggtcatagccgacatagatctgtggctcgcccggtga

DBGET integrated database retrieval system