KEGG   Spirochaeta thermophila DSM 6192: STHERM_c08530Help
Entry
STHERM_c08530     CDS       T01315                                 

Definition
beta-1,4-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
sta  Spirochaeta thermophila DSM 6192
Brite
Enzymes [BR:sta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     STHERM_c08530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
948386..949501
Genome map
AA seq 371 aa AA seqDB search
MMKTSTGSTHPVPRGAILIMAFLVGLGVLHPAGMKERSMAYAPLKEVYKDYFSIGAAVKL
GEYNSTPFYQAYGEDVLQHFDSFTAENGMKPENVYRNGTYDFTYGDRLVRYAREHGAVVR
GHTLVWHNQTSSLIPRPLPKEEARRLLEEYISTVAGHFRGGIHAWDVVNEAVGDGSQWRT
SSPWYQSYGGPEYIREAFEYARMADPDARLFYNDYNVVQPAKRARIVRMIEELDLVEAGL
DGIGIQAHWNLQWPSAEEISRTIETFASMGLEVHITELDIDCYNGNPAAPEMAYTSELEE
KLARRYAEIFEVLRRHKGEVTSVTFWGIADPDSWLNGFSGGRFLEKRRENYPLLFDGKGD
PKEAFFSIINW
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagacaagtacgggaagtacacaccctgtaccaagaggtgccatcctcatcatg
gccttcctggtggggctgggggtcctccatcccgcgggtatgaaggagcgttccatggcg
tatgcccctctcaaagaggtatataaagactacttctccatcggtgctgcggtgaagctg
ggcgagtacaacagcacgcccttctaccaggcctacggagaggatgtgcttcagcacttc
gactcgttcaccgcagagaacgggatgaagcccgagaacgtctaccggaatggcacctac
gacttcacctacggcgacaggctcgtccgatacgcccgggagcatggggccgtggtgaga
ggccacaccctcgtgtggcacaaccagacctcctccctcatcccacgcccgctccccaaa
gaagaggcacggcggctcctcgaggagtacatcagcactgtggcgggccatttccggggg
gggatccatgcctgggacgtggtgaacgaggcggtgggtgacggctcgcagtggcgcacc
tcttctccctggtaccagtcgtatggagggcccgagtacatcagggaggccttcgagtat
gcgcggatggcggatcccgacgccaggctcttctacaacgactacaacgtggtccagccc
gcaaagagggcacggatcgtccgcatgatcgaggagctcgatctcgtcgaggccggtctc
gacggcatagggatccaggcccactggaacctccagtggccctctgccgaggagatctcc
aggacgatcgagaccttcgcctccatggggcttgaggtgcacatcaccgagctcgacatc
gactgctacaacggcaaccccgcggccccggagatggcgtacacatcggaactcgaagag
aagctcgcccgtcgctacgcggagatattcgaggtcctcaggcgacacaagggcgaggtc
acatcggtcacgttctggggtatcgcggatcccgattcgtggctcaacgggttctcggga
ggacgctttcttgaaaagcgaagggagaactatcccctgctcttcgacggaaagggcgat
cccaaggaggcctttttctcgatcatcaactggtag

DBGET integrated database retrieval system