KEGG   Spirochaeta thermophila DSM 6192: STHERM_c09700Help
Entry
STHERM_c09700     CDS       T01315                                 

Definition
hypothetical protein
Organism
sta  Spirochaeta thermophila DSM 6192
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1061183..1062265)
Genome map
AA seq 360 aa AA seqDB search
MSITPRKALQDVPRIIHGGLHGGSSRLLDFSVNLNPFPIPRVIRRAVIRGIRHAYPDTAA
ALLIDALSTHLSVPSDWLMALNGTSEGILLLSLCYLSPGDSVLIVSPTYQEYERAALLME
ARVHHHRLEERALFGLHTERLEDDIRRIRPRLLWIGSPNNPTATHLTQEQVREILSVCES
TGTLFILDEAYANFLPSGPLSPLQPFVRSGHLAVLRSMTKDYLLTPLRLGYIVAHPDIIS
TLKKAQPPWSVNIPAQEAGRAAIRITDVFARQWRAARNLARDLRHAIESLGYPTIPSECN
FFLSHVGDSSGITAALQTLGVVVRDCSSFGLPSYIRIGTRTARDNALLIRALRHVGRKRP
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcacacctcgcaaggcgctccaggacgttccacggatcatccacggaggactc
catggaggatcctcacgcctcctcgacttcagcgtgaacctcaatcccttccccatccct
cgggtgatacggcgtgcggtcatccggggcatacgtcacgcgtatccggacaccgccgcg
gccctcctcatcgacgccctcagcacccacctgtccgtcccgagcgattggctgatggcc
ctcaacggtacctccgaggggatactcctgctctccctctgctatctttcgccgggggat
tccgtcctcatcgtgtctcccacgtatcaggaatacgagcgggctgcactgctcatggaa
gcacgtgtccaccatcatcgcctcgaggagagagccctcttcgggctccacacggaacgt
ctcgaggacgacatccgtaggatccgcccccggctcctctggatcggcagccccaacaac
cccaccgccacacacctcacccaggaacaggtgcgcgaaatcctctcggtctgtgaatcg
acgggcacgcttttcatcctcgacgaggcgtacgccaacttcctcccctcgggccccctt
tcgccgctccaacccttcgtgcggagcggtcacctcgccgtactccgatccatgaccaag
gactatctcctgactcccctacgcctgggctacatcgtcgcccatccggacatcatctcc
accctcaagaaggcgcaacccccctggtcggtgaacatccctgcccaggaggcgggccgt
gccgccatccggatcacggatgtcttcgccaggcaatggcgggccgcccgcaacctcgcc
cgtgatctccgccacgccatcgagtccctcggatatcccaccataccctcggagtgcaac
ttctttctctcacacgtgggagactcctccgggatcaccgcagccctccagacactggga
gtggtggtgagggactgctcgtccttcgggcttccttcctacatacgcatagggacgaga
acggcccgcgacaacgccctcctcatccgggccctccggcacgtcgggagaaagcggccg
tag

DBGET integrated database retrieval system