KEGG   Spirochaeta thermophila DSM 6192: STHERM_c09700Help
Entry
STHERM_c09700     CDS       T01315                                 

Definition
(RefSeq) hypothetical protein
  KO
K04720  
threonine-phosphate decarboxylase [EC:4.1.1.81]
Organism
sta  Spirochaeta thermophila DSM 6192
Pathway
Porphyrin and chlorophyll metabolism
Brite
KEGG Orthology (KO) [BR:sta00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    STHERM_c09700
Enzymes [BR:sta01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.81  threonine-phosphate decarboxylase
     STHERM_c09700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1061183..1062265)
Genome map
AA seq 360 aa AA seqDB search
MSITPRKALQDVPRIIHGGLHGGSSRLLDFSVNLNPFPIPRVIRRAVIRGIRHAYPDTAA
ALLIDALSTHLSVPSDWLMALNGTSEGILLLSLCYLSPGDSVLIVSPTYQEYERAALLME
ARVHHHRLEERALFGLHTERLEDDIRRIRPRLLWIGSPNNPTATHLTQEQVREILSVCES
TGTLFILDEAYANFLPSGPLSPLQPFVRSGHLAVLRSMTKDYLLTPLRLGYIVAHPDIIS
TLKKAQPPWSVNIPAQEAGRAAIRITDVFARQWRAARNLARDLRHAIESLGYPTIPSECN
FFLSHVGDSSGITAALQTLGVVVRDCSSFGLPSYIRIGTRTARDNALLIRALRHVGRKRP
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcacacctcgcaaggcgctccaggacgttccacggatcatccacggaggactc
catggaggatcctcacgcctcctcgacttcagcgtgaacctcaatcccttccccatccct
cgggtgatacggcgtgcggtcatccggggcatacgtcacgcgtatccggacaccgccgcg
gccctcctcatcgacgccctcagcacccacctgtccgtcccgagcgattggctgatggcc
ctcaacggtacctccgaggggatactcctgctctccctctgctatctttcgccgggggat
tccgtcctcatcgtgtctcccacgtatcaggaatacgagcgggctgcactgctcatggaa
gcacgtgtccaccatcatcgcctcgaggagagagccctcttcgggctccacacggaacgt
ctcgaggacgacatccgtaggatccgcccccggctcctctggatcggcagccccaacaac
cccaccgccacacacctcacccaggaacaggtgcgcgaaatcctctcggtctgtgaatcg
acgggcacgcttttcatcctcgacgaggcgtacgccaacttcctcccctcgggccccctt
tcgccgctccaacccttcgtgcggagcggtcacctcgccgtactccgatccatgaccaag
gactatctcctgactcccctacgcctgggctacatcgtcgcccatccggacatcatctcc
accctcaagaaggcgcaacccccctggtcggtgaacatccctgcccaggaggcgggccgt
gccgccatccggatcacggatgtcttcgccaggcaatggcgggccgcccgcaacctcgcc
cgtgatctccgccacgccatcgagtccctcggatatcccaccataccctcggagtgcaac
ttctttctctcacacgtgggagactcctccgggatcaccgcagccctccagacactggga
gtggtggtgagggactgctcgtccttcgggcttccttcctacatacgcatagggacgaga
acggcccgcgacaacgccctcctcatccgggccctccggcacgtcgggagaaagcggccg
tag

DBGET integrated database retrieval system