KEGG   Spirochaeta thermophila DSM 6192: STHERM_c09810Help
Entry
STHERM_c09810     CDS       T01315                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sta  Spirochaeta thermophila DSM 6192
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sta00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    STHERM_c09810
   01230 Biosynthesis of amino acids
    STHERM_c09810
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STHERM_c09810
   00051 Fructose and mannose metabolism
    STHERM_c09810
   00562 Inositol phosphate metabolism
    STHERM_c09810
Enzymes [BR:sta01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     STHERM_c09810
Exosome [BR:sta04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   STHERM_c09810
  Exosomal proteins of bladder cancer cells
   STHERM_c09810
  Exosomal proteins of melanoma cells
   STHERM_c09810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1072881..1073642
Genome map
AA seq 253 aa AA seqDB search
MTERRPFIAGNWKMHKTTGEARALAEALVENLKDCPHKVMVAPPFTALSAVREVLKGSPI
LLGAQNMCSVREGAHTGEISVLMLKDLDVSVVILGHSERRLIYGETDRLINEKVRLALEE
GMEVILCVGETLEQREAGKAEQVVEEQVKRGLDGVAPEDLSRVTIAYEPVWAIGTGRTAR
PEDADAMHRHIRRTVAGLHGTDAAEALIIQYGGSVKPSNIKALMAMENIDGALVGGASLS
AENFLPIVNFHLE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtgactgagagacggcctttcatcgcaggaaactggaagatgcacaagacgacaggggag
gctcgcgcccttgcggaggcccttgtggagaacctcaaggactgcccccacaaggtgatg
gtcgctcctcccttcactgccctctccgcggtgcgggaggtgctgaagggatcccctatc
ctcttgggggcacagaacatgtgttccgtgagggagggcgcccacaccggtgagatctcc
gtcctcatgctcaaggatctcgatgtctcggtggtgatactgggccattccgaacgacgt
ctcatctatggagagaccgacaggctcatcaacgaaaaggtacgcctcgcgctcgaagag
gggatggaggtgatcctctgcgtgggggagaccctcgaacagagggaggccggcaaggca
gaacaggtggtcgaggagcaggtgaagcgagggctcgatggggtggccccggaggatctc
tcccgtgtgaccatcgcgtatgaaccggtatgggccatcggtacggggcggaccgcgcga
cctgaagatgccgatgcgatgcacaggcacatccgcaggaccgttgcaggtctacacggt
acggatgcggcggaggccctcatcatccaatatgggggctccgtgaagccgagcaatatc
aaggcgctcatggcgatggagaatatcgacggggcgctggtgggcggcgcctccctctcc
gcggagaacttcctgcccatcgtaaactttcatctggagtga

DBGET integrated database retrieval system