KEGG   Spirochaeta thermophila DSM 6192: STHERM_c10370Help
Entry
STHERM_c10370     CDS       T01315                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.-)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sta  Spirochaeta thermophila DSM 6192
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sta00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    STHERM_c10370
Enzymes [BR:sta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     STHERM_c10370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1129712..1130620
Genome map
AA seq 302 aa AA seqDB search
MWSTRTRGRNGREAMVLSPAKVNFHLEILDTREDGYHNIRSIFQTVSIFDRIWIRSLTDT
EEDVVDGVPATPEESTVHRAVRIFREATGWRGYVHVKVEKRIPSGAGLGGASSNAAAVLR
ALDALTGVGLGEERLAELGLKVGSDVPFFCRASAALVEGRGEVIHPVKPRDDFWLLCVAP
GFPISTVQAYALYDERKGLVMHEGVSPRRIVESYESYAPQDWGFHNAFFDVLVPRYPLLQ
DIVQGLAELGALYANVSGSGSVVYGVFPSFIDLVRADAAMVRQGYETYRAHPLKRLPRVW
CA
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgtggagcactagaacgagaggtcgaaacggccgggaggccatggtgctctcccctgcc
aaagtgaacttccatctcgaaatacttgacacgagggaggatggttatcataatatacga
tcgatattccagacggtatccatattcgaccggatatggattcgctctttgacagacacg
gaagaagatgtagtggatggtgttccggccactcctgaagagagtactgttcacagggca
gtccggatcttcagagaggcgacagggtggagaggatatgtccatgtcaaggtggaaaag
cgcatcccttccggggcgggtctcggcggggcttcgagcaatgctgctgccgtgctgagg
gcgctcgatgccctcacgggagtcggtttgggagaagaacgactcgctgagctcggacta
aaggtgggcagcgacgtccccttcttttgtcgtgcttcggccgccctcgtggagggaagg
ggggaggtgatccatccggtgaaacccagggacgacttctggctcctctgtgtggcaccc
ggattccccatatccaccgtgcaggcgtacgccctttatgatgaacggaaaggtctcgtg
atgcacgagggggtgtccccgaggcggatcgtggagtcctatgagtcgtacgcaccgcaa
gactgggggtttcacaatgcgtttttcgacgtactcgttccccgatatcctctcctccaa
gatatcgtgcaggggttggctgagctaggggccttgtacgcgaacgtctcaggtagtggg
agtgtggtgtacggggtttttccctcctttatcgatcttgtgagggcggatgctgcgatg
gttcgacagggctatgaaacgtatcgagctcaccccctgaagcggttgcctcgtgtatgg
tgcgcctga

DBGET integrated database retrieval system