KEGG   Spirochaeta thermophila DSM 6192: STHERM_c11010Help
Entry
STHERM_c11010     CDS       T01315                                 

Definition
hypothetical protein
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sta  Spirochaeta thermophila DSM 6192
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sta00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1193549..1194049)
Genome map
AA seq 166 aa AA seqDB search
MATTYIAVGSNRGDSLGIVGRLLSALRKRDPELRCASLYRSEPMYLRDQPDFLNTVIEFH
TDLHPEALLRFLQELETNAGRNRAEEPRYGPRPLDLDILLYDDLLLTTPSLQIPHPRMQE
RLFVLVPLLELAPDLVDPRDGVPFRVKQEQAALHHPLHLEKIAPLV
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgacgtatatcgctgtgggttcgaacaggggagattccctcggtatagtggga
cgcctcctttctgccctcaggaagagggacccggagctgaggtgtgcttcgctctacaga
tcggaacccatgtacctgagggaccaacctgacttcctcaacacagtgattgagttccat
accgaccttcaccccgaagccctcctgaggtttctccaggagctcgaaaccaacgcgggc
aggaacagggccgaagaaccacgttacggcccgagaccgctcgatctcgacatactcctc
tacgacgatctgctgctcaccaccccttccctccagatcccccatcccaggatgcaggaa
cgactcttcgtgctcgtgcctctcctggaactcgcccctgacctcgtggacccccgggac
ggagtcccgttccgggtgaaacaggagcaggccgctctccaccatcctcttcaccttgaa
aaaatagcgccactggtatag

DBGET integrated database retrieval system