KEGG   Spirochaeta thermophila DSM 6192: STHERM_c11010Help
Entry
STHERM_c11010     CDS       T01315                                 

Definition
hypothetical protein
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sta  Spirochaeta thermophila DSM 6192
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sta00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    STHERM_c11010
Enzymes [BR:sta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     STHERM_c11010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1193549..1194049)
Genome map
AA seq 166 aa AA seqDB search
MATTYIAVGSNRGDSLGIVGRLLSALRKRDPELRCASLYRSEPMYLRDQPDFLNTVIEFH
TDLHPEALLRFLQELETNAGRNRAEEPRYGPRPLDLDILLYDDLLLTTPSLQIPHPRMQE
RLFVLVPLLELAPDLVDPRDGVPFRVKQEQAALHHPLHLEKIAPLV
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgacgtatatcgctgtgggttcgaacaggggagattccctcggtatagtggga
cgcctcctttctgccctcaggaagagggacccggagctgaggtgtgcttcgctctacaga
tcggaacccatgtacctgagggaccaacctgacttcctcaacacagtgattgagttccat
accgaccttcaccccgaagccctcctgaggtttctccaggagctcgaaaccaacgcgggc
aggaacagggccgaagaaccacgttacggcccgagaccgctcgatctcgacatactcctc
tacgacgatctgctgctcaccaccccttccctccagatcccccatcccaggatgcaggaa
cgactcttcgtgctcgtgcctctcctggaactcgcccctgacctcgtggacccccgggac
ggagtcccgttccgggtgaaacaggagcaggccgctctccaccatcctcttcaccttgaa
aaaatagcgccactggtatag

  All links  
No link information was found.   
DBGET integrated database retrieval system