KEGG   Spirochaeta thermophila DSM 6192: STHERM_c12290Help
Entry
STHERM_c12290     CDS       T01315                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
sta  Spirochaeta thermophila DSM 6192
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:sta00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    STHERM_c12290
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    STHERM_c12290
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    STHERM_c12290
Enzymes [BR:sta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     STHERM_c12290
Exosome [BR:sta04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   STHERM_c12290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1333432..1334892
Genome map
AA seq 486 aa AA seqDB search
MKKLIVSLLLLVSLLPMGAGGTRETGSAPEVSPEPSQPKVKYIFFFIGDGMGLPQINAAE
AYLMAREQKDAPVRLSFTAFPATGMATTYSSDSYITDSAAAGTALAAGRKTANGVINMDP
GKTRTFTTIAERLHERGLKVGIISTVSIDHATPASFYAHQPSRSNYYEIGLELVKSGFEF
FGGGGFRDPEGKRSKREGGKSNVLEEARKAGYTILTTEEEILGLSPGSAQKVIAINPVLP
SSAAMPYKIDRDEESLDLADFTRKAVEFLDNPEGFFIMVEGGKIDWACHANDAVAAIQDV
LDFDEAVQVAVEFARRHPDETLIVVTGDHETGGLTIGFAGTRYENAFPVLLNQKVSFEGF
NAVFESYKGKKALTLDEVMPLVREYFGIESLTPYEEEVLSSALRASLEGVPEDDPQSYLL
YGGYEPFTVTLTHVVNNRAGLGWTTWSHTGVPVPVYATGPGAHLFTGYYDNTDIPKQIAR
LAGVDL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaactcatcgtatccctgttactactcgtttccctgctacccatgggggcaggg
ggaacgagggagaccggttccgctcccgaggtctccccagagccttctcagccgaaggtg
aagtacatcttcttcttcatcggggacggtatgggccttccgcagatcaatgcggccgag
gcctacctcatggcccgggagcagaaggatgccccggtacggctctcgttcaccgcgttc
cccgccaccggcatggcgaccacctattcctcggacagctacatcacggactcggcagcc
gcgggcaccgcactcgcggcgggcaggaagactgccaacggggtgatcaacatggacccg
gggaagacccggaccttcaccacgattgcagagcggctccatgaaagaggcctcaaagtg
ggtatcatctccacggtctccatcgaccacgccacccctgcgtctttctacgcccatcaa
cccagtagaagcaactactacgagatcggtctggagctcgtgaagagcgggttcgagttc
ttcggtggagggggattccgcgatccggagggaaagaggagtaagagggaaggagggaag
tccaacgtgctcgaagaggcgaggaaggccggctataccatcctcaccaccgaggaggag
atcctgggtctctctccagggtcggcgcagaaggtgatcgcgatcaatcccgtgctccct
tcatccgctgcgatgccctacaagatcgatagggacgaggagtctctcgatcttgccgac
ttcacacgaaaggccgtggagttcctcgacaatcccgagggcttcttcatcatggtggag
gggggtaagatcgactgggcctgtcatgcgaacgatgcagtggcggccatacaggacgtc
ctcgacttcgacgaggcggtgcaggtggccgtggagttcgcacggcgtcatccggatgag
accctcatcgtggtcaccggcgaccatgagacagggggactcaccatagggttcgccggc
acgagatacgagaatgccttcccggtgctcctcaaccagaaggtctcgttcgaggggttc
aatgcggtcttcgaatcatacaaggggaaaaaggctctcacgctcgacgaggtgatgccc
ctggtaagggaatacttcgggatcgagtccctcactccctacgaggaagaggtgctctcg
agcgccctccgggcgagcctggaaggcgttcccgaggatgatccgcagtcctacctcctc
tacggtgggtacgagccgttcaccgtgaccctcacccatgtggtgaacaaccgtgccggc
ctcggctggacgacctggagccacacgggagtgcctgtgccggtctatgccacaggcccc
ggggctcacctcttcacaggttactacgacaataccgatatcccgaagcagatcgcccgg
ttggcgggcgtggacctgtag

DBGET integrated database retrieval system