KEGG   Spirochaeta thermophila DSM 6192: STHERM_c12800Help
Entry
STHERM_c12800     CDS       T01315                                 

Definition
(GenBank) hypothetical protein
  KO
K22597  glucosylglycerate phosphorylase [EC:2.4.1.352]
Organism
sta  Spirochaeta thermophila DSM 6192
Brite
Enzymes [BR:sta01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.352  glucosylglycerate phosphorylase
     STHERM_c12800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: ADN02221
UniProt: E0RTJ0
Position
complement(1394004..1395767)
Genome map
AA seq 587 aa AA seqDB search
MEPVDRMRELLSFIYGPDTGRDTYEHLRALLERWRSRLPAPDEEYVSGRLPLDHTDAVLI
TYGDQFRREGEAPLATLGEFLREYLSGTMKGVHILPFFHYSSDDGFSVIDYRTVNPEWGT
WEEVRRISGEFRLMVDLVLNHCSAKSEWFRRFLQGDPAYEDFFITVEPGTDLSGVFRPRA
LPLVHEFESPKGPVLVWTTFSRDQVDLNYANPRVLLEMIDIFLFYVSQGAQIIRLDAIAY
LWKELGTPCIHHPKTHAVVKLFRAICEEVCPWVLIITETNVPHEENISYFGDMDEAHLVY
QFALPPLVLDAFLRKDVSYLREWARTIDTYGGKVSYFNFLASHDGIGVLPARGILPDEHI
DSMIEAVKDRGGLISYKSTPEGEVPYELNINYLSAISEAHLDRPTRARKFLASQAVMLSL
VGMPGIYVHSLLGSENWREGVEKTGMNRTINRQKCSYDEILRELEDPESLRSMVFKGYLD
MLAARRKSRAFDPRGTQEVLDAPETVLALMRRSHDATEEVLCLINVSHVEQECVFPSSIF
ASSPEVHLFTELTSGDTLVPYREDEDRFSISLGGYEVLWLTPYRDRD
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atggaacctgtcgatcgcatgagagagctcctctcgttcatctatggacctgacacggga
cgtgacacctatgagcaccttcgcgcccttctcgagaggtggaggagccgtcttcccgct
cctgacgaggagtatgtctccggccgccttccgctcgatcacaccgatgcagtcctcatc
acgtatggcgatcagttcagaagagaaggggaagcccccctcgctaccctcggagagttc
cttcgagagtacctctccggcacgatgaagggagtccacatcctccccttcttccactat
tcctcggacgacggattttcggtgatcgactaccgcacggtgaaccccgagtggggtacc
tgggaggaggttcgccgcataagcggagagttccggctcatggtggacctcgtactcaac
cactgttctgccaagagcgagtggttcaggcgcttcctccagggcgatcctgcgtacgag
gacttcttcatcaccgtggagcccggcaccgatctctcaggggtcttcagaccccgtgcc
cttccccttgttcacgagttcgagagtccgaaggggccggtactggtgtggaccaccttc
agccgggatcaggtcgacctcaactatgcgaacccgcgggtcctcctcgagatgatcgac
atcttcctcttctatgtctctcagggtgcccagatcatccgcctggatgctatcgcctat
ctctggaaggagctcggcaccccctgtatccaccaccccaagacccacgccgtggtgaag
ctcttcagggcgatctgtgaggaggtgtgcccctgggtcctcatcatcaccgagaccaat
gtcccccacgaggagaacatctcctacttcggggacatggacgaggcccatctcgtgtat
cagttcgccctccctcccctcgtcctggatgcctttctcaggaaggatgtctcctacctc
agggagtgggcccgcaccatcgacacctacggcggaaaggtgagctacttcaacttcctc
gcctcgcacgacggcataggggtgctccccgcccgggggatactccctgacgagcacatc
gactcgatgatcgaggcggtgaaggatagaggcggcctcatctcctacaagagcacaccc
gagggcgaggtgccctacgagctcaacatcaactacctgagcgccataagcgaggcacat
ctcgaccgccccaccagggcccggaagttcctcgcgagtcaggccgtgatgctctccctg
gtggggatgcccggtatctatgtccacagcctcctggggtcggagaattggcgtgagggt
gtggagaagaccgggatgaaccgcaccatcaaccgacagaagtgttcctacgatgagata
ctccgcgagctcgaggatcccgagagcctcaggagcatggtcttcaaaggctacctcgat
atgctcgccgcccgacggaagagtcgcgcctttgatcccagggggacgcaggaggtgctg
gatgcccccgaaaccgtgcttgccctcatgaggaggagccatgacgcaacagaggaggtg
ctttgcctcatcaatgtgagccacgtcgagcaggagtgcgtcttcccttcgtcgatattt
gcgagctcaccggaggtgcacctgttcaccgagctcacaagcggggataccctcgtcccc
taccgagaggacgaggaccgcttctccatctcgctcggcggctacgaggtcctctggctc
acaccctatcgggacagggactga

DBGET integrated database retrieval system