KEGG   Spirochaeta thermophila DSM 6192: STHERM_c13110Help
Entry
STHERM_c13110     CDS       T01315                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
sta  Spirochaeta thermophila DSM 6192
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sta00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    STHERM_c13110
Enzymes [BR:sta01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     STHERM_c13110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1424869..1426005
Genome map
AA seq 378 aa AA seqDB search
MKKRIIVLGCTGSIGRNALEVVRAYPERLEVVGLSAHTRDRELLAAAREFGVERLALTGK
RGGGVPYEGEEGLLHLIEETEADIVVNGIAGTRGLIPSLKALETGKDLALANKESLVVAG
ELLLETATRNGRHILPVDSEHAAIFSLLRNVPPDAVKALYLTASGGALRDIPLSRLEEIT
PEEALRHPTWEMGPKITIDSATLANKGLEVIEAAVLFGVPPESVRVVIHPQSVVHGLILL
RDGSWHAQMSTPDMRLPIQQALFHPEVPPQAPAPLLLEEGLDLSFRPVDGRRYPMLELAY
QALASQGKRIAFNAANEEAVRAFLEGRISFPRIAQVVESVLAREWPSPQGGISPILALDA
EVRRVTEGILKERSGHAS
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacggatcatcgtcctcggatgcacgggaagcatcggaaggaacgccctggaa
gtggtgcgggcctatcccgagcgcctcgaggtggtgggtctctcggcgcataccagggat
cgggagctcctcgcggccgcccgggagttcggcgtggaacgcctggcgctcacaggaaaa
cgaggcggaggggtcccttacgagggcgaggaaggtctcctccacctcatagaggagacc
gaagccgacatcgtggtgaacggtatcgcggggacgagaggcttgatcccctccctcaag
gccctcgagaccgggaaggacctcgccctcgccaacaaagagagcctcgtggtggcggga
gaactcctcctcgagacggccaccaggaacgggcggcacatccttcccgtggattccgaa
cacgcagccatcttctctctgctccggaatgttcctccggatgcagtgaaggccctctat
ctcaccgcctccgggggagcactgcgggatatccccctctcacgactcgaggagatcacc
cccgaagaggcgctcagacatcccacctgggagatgggccccaagatcaccatcgactcg
gccaccctcgcgaacaaaggactcgaggtgatcgaggccgcggtcctcttcggggtgccc
cccgaatccgtacgggtggtcatccacccccagagcgtggtacacggtctcatcctgctc
cgtgacgggtcgtggcacgctcagatgagcaccccggacatgcgacttcccatccaacag
gccctgttccatcccgaggtcccaccccaggcccccgctccgcttctcctggaggaggga
ctcgacctcagcttcagaccggtggacgggcggcggtaccccatgctcgagctcgcctac
caggctctcgcttcacaggggaagcgcatcgccttcaatgcagcaaacgaagaggccgtc
cgggccttcctcgagggcaggatctccttcccccggatcgcccaggtggtggaatccgta
ctcgccagggaatggccttcccctcagggagggatctcccctatactggcactggatgcc
gaagtgcgcagggtgacggaaggtatcctgaaagagaggagtggtcatgcttcttaa

DBGET integrated database retrieval system