KEGG   Spirochaeta thermophila DSM 6192: STHERM_c13550Help
Entry
STHERM_c13550     CDS       T01315                                 

Definition
hypothetical protein
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
sta  Spirochaeta thermophila DSM 6192
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sta00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1470587..1471618)
Genome map
AA seq 343 aa AA seqDB search
MGPIFPFSAIVGQEEAKQALLLGVIDPGIGGVLLFGEKGTGKTTLVRALASLVPGMPLVE
LPLNATEDRLVGSLNVEKALSEGVRQFEPGLLAAAHGGILYVDEVNLLEHHLVDLLLDVA
ATGVNRVEREGISYEHPARFLLVGSMNPEEGDLRPQFLDRFGLAVPVRHLEDPDLRAEVV
RRRLAFESDPEGFVRAWREEDALASQVAVARERLRRVGVAEEVYAEAVRIAGVLGARGHR
AELVMVRAARALAAFLERDEADTALVRAVARYALVHRVRIGPGEREDAVLRRIDAAVEGR
EGEREVEGEMVEPEDAVVPGAAAAGSLMFEFVKKKLTRWSTSR
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgggtcccatcttcccgttttccgcgatcgtggggcaggaagaggcgaagcaggcgctc
ctcctgggggtgatcgatccggggatcgggggggtgctcctcttcggggagaaggggacg
ggtaagaccacgttggtgagggccctcgcctcgctcgtgccggggatgccgctggtggag
cttcccctcaatgccaccgaggacaggctggtggggtcgctcaacgtggagaaggccctc
tccgagggggtgcgccagttcgagccggggctcctcgctgcagcgcacggggggatcctc
tatgtggacgaggtgaacctgctggagcaccacctggtggacctgctcctggatgtggcg
gcgacgggggtgaatcgtgtggagcgggaggggatctcctacgagcatcccgcccggttc
ctcctcgtgggttcgatgaatccggaggagggggatctccgtccgcagttcctcgaccgt
ttcggtctcgcggtgccggtgcggcatcttgaggatccggacctgcgggccgaggtggtg
cgccggcggctcgccttcgagtccgatcccgaggggtttgtgcgtgcgtggcgggaggag
gatgcgctcgcctcccaggtggcggtggcgcgggagcggctgaggagggtgggggtggct
gaggaggtgtatgccgaggcggtacggatcgccggcgtgctcggggcgcgggggcatcgg
gccgagctggtgatggtgcgggcggcgagggcgctcgcggcgtttctcgagcgggatgag
gcggatacggcgctggtgcgggcggtggcgcggtatgcgctcgtgcacagggttcggatc
gggccgggcgagcgtgaggatgcggtgctccgaaggatcgatgcggcggtggaggggcgg
gagggggagcgggaggtggagggggagatggtggagccggaggatgcggtggtgccgggg
gctgcggcggcaggttcgctcatgttcgagttcgttaaaaaaaaactgacgaggtggtcc
acgagccggtag

DBGET integrated database retrieval system