KEGG   Spirochaeta thermophila DSM 6192: STHERM_c14000Help
Entry
STHERM_c14000     CDS       T01315                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sta  Spirochaeta thermophila DSM 6192
Brite
Enzymes [BR:sta01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     STHERM_c14000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1518267..1518890
Genome map
AA seq 207 aa AA seqDB search
MEKDVLIRLLEREGIHDRRILDAIDKVPREEFVPPAQRQYAYENIPLEIGWGQTISQPYT
VAFMIQLLELRPGLKVLEVGGGSGYNAAVMWEVMDRTGDLYSMEIHPEVYRMGKANLERT
GYTEINFMLGDGSKGLPEEAPFDRIVVTAAAEETPSTLLSQLGEGGILVIPVHVGGGTSV
MTRILREGGAFHTSTHGYFRFVPLVTR
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagatgtcctcatccgtctcctcgagcgtgaaggaatacacgaccggaggatc
ctcgacgccatcgacaaggtcccacgagaggagttcgtgccccctgcgcaacgacagtac
gcctacgagaacatccccctcgagataggctggggacagacgataagtcagccctacacc
gttgccttcatgatccagctcctcgagcttcgacccggactcaaagtcctggaggtaggg
ggaggctcgggctacaacgccgctgtcatgtgggaggtgatggaccgcacgggagacctg
tactcgatggagatccaccccgaggtgtaccggatgggaaaggccaacctcgaacggacg
gggtacaccgagatcaacttcatgctcggtgacggctcgaaggggctcccggaagaggcg
cccttcgaccgcatcgtcgtgacagccgcagccgaggagacgccttccaccctgctctcg
cagctcggagaggggggaatcctcgtcatccctgtacacgtgggcgggggcacgtcggtc
atgacccgcatcctccgcgagggcggcgcgttccacacatccacccacggctacttcagg
ttcgtgccgctcgtgacgcggtga

DBGET integrated database retrieval system