KEGG   Spirochaeta thermophila DSM 6192: STHERM_c14520Help
Entry
STHERM_c14520     CDS       T01315                                 

Definition
endo-1-4-beta glucanase, glycosyl hydrolase family 5
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
sta  Spirochaeta thermophila DSM 6192
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sta00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    STHERM_c14520
Enzymes [BR:sta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     STHERM_c14520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1579750..1580745)
Genome map
AA seq 331 aa AA seqDB search
MKRKWIIVLAAGVVLAAGVGVGLRLATGGSVVDRHGMLQVRGSAICDAHGRQIQLRGMSL
FWSQWSAPFWNPELVRNLARTWKVSLIRAAMGVENAYLTSNKYHKNLLMKVVDAAIEEGI
YVIIDWHSHNIYLPQAEAFFAEMAERYGNVPNVIFEIYNEPDTETWDEIKAYAVRIIETI
RSKGAKNLIIVGTPHWSQDVDVAADDPITGYENIAYTLHFYAGTHREDLREKARYALSKG
LPLFVTEWGTCEASGDGPIDIEESERWLAFLDEHMISWANWAMNDKRESASALVFGASTT
GPWPDEQLTESGRFVKAKIMEAPVRVGRRVE
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaagcggaagtggatcatcgtgctcgcggcgggggtggtgctcgcggcgggcgtgggg
gtggggctccgcctcgccaccggcgggtcggtggtggatcggcacgggatgctccaggtg
agggggagtgcgatctgcgacgcccatgggcggcagattcagcttcgcgggatgagcctc
ttctggagccagtggtcggcgccgttctggaatccggagctggtgagaaacctcgcccgt
acctggaaggtctccctcatcagggcggccatgggagtggagaacgcctacctcacgagc
aacaagtaccacaaaaacctcctcatgaaggtggtggatgccgccatagaggagggcatc
tacgtgatcatcgactggcactcacacaacatctacctcccgcaggccgaggccttcttt
gccgagatggccgagcgctacggcaatgtgcccaacgtgatcttcgagatctacaacgag
cccgacaccgagacgtgggacgagatcaaggcctatgcggtgcgcatcatcgagaccata
cgctcgaagggggcgaagaacctcatcattgtgggcacgccgcactggtcgcaggacgtg
gatgtggcggccgacgatccgattacagggtacgagaacatcgcctataccctccacttc
tacgcagggacgcaccgggaggatctgagggaaaaggcccggtatgccctctccaagggg
ctccccttgttcgtgaccgagtggggaacctgcgaggcctcgggcgacgggccgatcgat
atcgaggaatcggaacgctggctcgcctttctcgacgagcacatgataagctgggccaac
tgggccatgaacgacaagcgtgagagcgcctcggccctggtcttcggggcaagcaccaca
gggccctggcccgatgagcagctcaccgagtcgggacggtttgtgaaggcaaagatcatg
gaggctccggtgcgcgtggggaggcgagtggagtag

DBGET integrated database retrieval system