KEGG   Spirochaeta thermophila DSM 6192: STHERM_c14620Help
Entry
STHERM_c14620     CDS       T01315                                 

Definition
glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sta  Spirochaeta thermophila DSM 6192
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sta00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    STHERM_c14620
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    STHERM_c14620
Enzymes [BR:sta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     STHERM_c14620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1592694..1594376)
Genome map
AA seq 560 aa AA seqDB search
MMEWMSRAPFSLSPQDRRWVEETFRSLSLEEKVGQVFVLLCDELSEEKMQYVLGLKPGGI
HRFPNGVSWETLASSAVFLQEHSRVPLLLTGDLEFSFFAVKIGDEGSEFQTQMGVAASSD
PLRDVERMARIAAREGRALGYNVTFSPVVDINYNFRSTITGTRTFGSDADMVRRLSEVYV
RVLQEEGMGACAKHWPGDGVDDRDQHLVTSCNSLSRDVWEASYGEVYRGVIQAGVQSIMS
AHICAPALVDGPDRFVPASLSGDLTITFLRERLGFNGVVISDATPMAGFASQGKREDLLP
RALDAGCDIILFSEDPEEDVQIVLDAVKSGRVAPERLDEAVLRILAWKAALGLHRVEDWS
SHVRGLMEEARASREEHARWAEECFASSITLVKHENDILPISPQRYRRVLLLESRPPEVF
GPSGFTPFKDYLEQEGFWVTRMEADVLPDPDLYDLAIYLLDHYTFMSEGRASIPWAELHG
GAFRSMWRFWDDIPTVMISLSSPYFLFEAPTVGTYVNVYSPAEVGLKVLVDLLMGRREFR
GRNPVDPFCGMEDVRGSCGG
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgatggagtggatgagccgagcaccgttttctctttctcctcaggaccggcgttgggtg
gaggagacgttccgatccctctctctcgaagagaaggtcggtcaggtcttcgtcctgctg
tgcgacgagctctccgaggagaagatgcagtacgtcctgggactcaagcccggagggatc
catagattcccgaacggagtctcgtgggagacgctcgcttcctcggccgtgttcctccag
gaacactcacgcgtccccctcctcctcaccggcgacctcgagttttccttctttgcggtc
aagatcggtgatgaggggagcgaattccagacacagatgggggtggccgcatcgtccgat
cccctcagggatgtggagaggatggcccgtatcgctgccagggaggggcgggccctgggc
tacaatgtgaccttctcccccgtggtggatataaactacaacttcaggagtaccatcacc
ggaacgaggaccttcgggagcgatgccgacatggtgaggcgtctctccgaggtctacgtc
agggtgctccaggaagaggggatgggggcctgtgcgaagcactggccgggagacggggtg
gacgatcgcgatcagcacctggtgacgtcgtgcaacagcctttcccgcgatgtgtgggag
gcgagctacggtgaggtctaccgaggggtgatacaggccggagtgcagagcatcatgagc
gcccacatctgcgcccctgcgctcgtggacggtcccgatcgtttcgtgccggcctctctc
tcgggggatctcacgatcacattccttcgggagcgcctgggtttcaatggcgtggtgatt
tcggatgccacccccatggcgggtttcgcctcacaggggaagagggaggatctcctgccc
cgggccctcgatgcgggatgcgatatcatactcttttccgaggatcctgaggaagatgtc
cagatcgtcctcgatgcagtgaagtcggggcgggtggctcccgagcggttggacgaggcg
gtgttgcgtatcctcgcctggaaggcggcgctcggccttcaccgcgttgaggactggtcc
tcgcacgtgagagggctcatggaagaggcgagggcgtcgagggaggaacacgcccggtgg
gccgaggagtgtttcgcctcgtccatcacgctggtgaagcacgagaacgatatcctgccc
atctcgccgcagcggtaccgtcgggtgctcctgctggagagccggcctcccgaggtcttc
gggccttcggggttcacccccttcaaggactatctcgagcaggaggggttctgggtgacc
aggatggaggcggatgtgctccccgatcctgatctctacgatctggccatctacctgctc
gatcactacaccttcatgagtgaagggcgggcttcgatcccctgggcggagttgcatggg
ggagcattccgatcgatgtggcgcttctgggacgacatccccacggtgatgatttccctg
agcagtccgtatttcctcttcgaggcgcccacggtggggacgtatgtgaacgtgtattcc
ccggctgaggtgggcctcaaggtgctggtcgatctcctcatggggaggagggagttccgg
gggagaaaccccgtggatccgttctgtggaatggaggacgtgaggggctcctgtggcggg
taa

DBGET integrated database retrieval system