KEGG   Spirochaeta thermophila DSM 6192: STHERM_c15610Help
Entry
STHERM_c15610     CDS       T01315                                 

Definition
hypothetical protein
Orthology
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
sta  Spirochaeta thermophila DSM 6192
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sta00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    STHERM_c15610
Enzymes [BR:sta01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     STHERM_c15610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1702878..1704473)
Genome map
AA seq 531 aa AA seqDB search
MKKTTQLKRLLLSDDVEFLMEAHNGISAKIVEEAGFKGIWASGLTISASLGVRDNNEASW
TQVLEVVEFMSDATNIPILLDGDTGYGNFNNARRLVRKLEQRGVAGVCIEDKLFPKTNSF
ISGETQPLANTEEFCGKIKAMKDIQEDPDFVVVARVEAFIAGWGLEEALRRAEAYRQAGA
DAVLIHSKRSDFREIEAFMREWGNRLPVVIVPTKYYSTPTDVFRSAGVRLVIWANHNLRA
AISAMQHVSAAIFKSETLMVVEDQIAPLSEVFRLQGASELEAAEEKYLPTAGKKVNAVIL
AAAQGEKLGDLTSTTPKAMLKVHGKPILGLIVEKLNRVGVKDITVVRGFAKEKIQMPNTT
TVDNDRYAETSEVYSLYLARDRIKENTVISFGDIVFKSWILNELLNDDAPVTIIVDAEIQ
KDDSWRDYVVCDRAYSRTLFNTPVALRTMSHTLSPDEAHGEFIGLFKVTKEGAEALTALL
QELADEGIIECVRIDEMFTRLASRVRVGVKYILGSWVDVNMLVDLQRAGEL
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaccactcaactgaaacgacttttactctctgatgacgttgaattcctcatg
gaagcacataatggaatctcggcgaaaatcgtagaggaagcggggttcaaagggatctgg
gcttccggtcttactatctcggcctccctaggggtcagggacaacaatgaggcatcatgg
acccaggtcctggaggtggtggagttcatgagtgatgctacgaacataccgatcctgctg
gatggcgatacagggtatggaaatttcaacaacgcgaggcggcttgtaaggaaattggag
caacgcggagttgcgggtgtttgtatcgaagacaagttgttccccaagaccaactctttc
atatccggagagacccaaccgctggctaatactgaggagttttgtggcaagataaaggcc
atgaaggatatccaggaagatcctgatttcgtggtggtcgcgagggtggaggcctttatc
gccgggtgggggcttgaagaagccttgcggagggccgaagcgtatcgccaagcaggagca
gatgctgttctcatacactccaaacgttctgattttagagaaattgaagccttcatgcgg
gagtgggggaatcgtttgcctgtggtgatcgtgcctaccaagtattattcgactcctacc
gatgtgtttcgatccgcaggggtgaggctggtaatctgggcgaaccataacttacgggct
gctatttctgctatgcagcatgtgagtgccgccattttcaagagcgagacactcatggtg
gtggaagatcagatagccccactctcggaggtgttcaggctccagggagcgtctgagctt
gaagctgcggaggagaagtaccttcccacagcagggaaaaaggtgaatgctgtgatcctt
gctgcggcccaaggggagaaattgggggatctcacctcaacaactcccaaggcgatgttg
aaggtgcacggtaagcctatcttggggcttattgtagagaagctcaatagagtaggtgtc
aaagatatcacagtggtgcgcggttttgcgaaagagaagatacagatgcccaatacaaca
acagtagataatgatcgttatgcggagacttctgaagtgtactctctctatcttgcgagg
gatagaatcaaagaaaacacggtcatatccttcggggatatcgtattcaaaagctggatc
ctcaatgaattgctgaacgatgatgctcctgtgacaatcatcgtggatgcggagattcaa
aaggatgattcatggcgggattacgtggtatgtgatcgggcatattcccgaacgttgttc
aatacccctgtggcattgaggaccatgagtcataccctctcccctgatgaagcacatggg
gaatttataggccttttcaaagtcacaaaggaaggggccgaggcccttaccgcccttctg
caggaactcgcagatgaaggaattatcgaatgtgtgcggatcgacgaaatgtttacccgt
ctggcctcccgtgtgagagtgggggtgaaatatatccttggctcatgggtggatgtgaac
atgctggttgatcttcagagagcaggagagttgtga

DBGET integrated database retrieval system