KEGG   Spirochaeta thermophila DSM 6192: STHERM_c15980Help
Entry
STHERM_c15980     CDS       T01315                                 

Definition
alpha-amylase type A isozyme precursor (EC:3.2.1.1)
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
sta  Spirochaeta thermophila DSM 6192
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sta00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    STHERM_c15980
Enzymes [BR:sta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     STHERM_c15980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1756023..1757336
Genome map
AA seq 437 aa AA seqDB search
MRRDRRDLWLPLLFLILLITGCPTHYDEEGGEVSRAAYFGSRADVMLQGFHWESHQSSIP
WWDVIAQNADTIASAGFTVVWLPPPSDAASDEGYLPREWYNLSSSYGEQSQLTSAISALH
RRGIKVLADIVVNHRVGTYDWADFSDPAFDDNARAVTSDDEWGYGTGNPDTGDGFSAARD
LDHTYYDVQDEIIYWLSWLKHSMGFDGWRYDYVRGYSGYYVGIYNDATSPYLSVGELWPD
ITGDYYASGDAVNYHRQRLMDWIDATGGKSMVFDFTTKWQLQLAVERSEYWRLVDSQGKP
IGAIGWWPQMSVTFIDNHDTGPSPGGGQNLWPFPSDKVEEGYAYILTHPGVPCVYWPHFF
DWGSDLRNKISTLIQIRRNKGITSTSSVDVLAADSGKYVARIDDVLIVKIGPDLSYNPSS
EWTLTAYGNDWAVWTKE
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgagacgagacagacgcgacctctggctccctctcctcttcctcatcctactcatcacg
gggtgccccacccactacgatgaagagggaggagaggtgtcccgcgcggcctacttcggt
tcgcgtgccgacgtcatgctccaggggttccactgggaatcccatcaaagctccattccc
tggtgggatgtgatagctcagaacgccgataccatcgcctcggcaggcttcacggtagtc
tggcttccccctccctccgatgcggcatcggatgagggctaccttcccagggagtggtac
aacctctcttcctcttatggggagcagtctcaactcacctcggcaatcagcgcccttcac
cgcagggggataaaggtactcgccgacatcgtggtgaaccaccgtgtcgggacctacgac
tgggccgatttttccgaccccgctttcgatgacaacgcccgggcagtcaccagtgacgac
gagtggggatacggaaccgggaaccccgacaccggagatggcttctcggcggcaagggat
ctcgaccacacctactacgacgtacaggatgagatcatctactggctctcctggctcaag
cacagcatgggattcgacgggtggcgctacgactacgtgcggggatacagcgggtactac
gtgggaatctacaacgacgccaccagcccctacctctcggtgggggaactctggcccgat
atcacgggcgactactatgcctcgggagatgcggtgaactaccaccggcagaggctcatg
gactggatcgacgccacaggggggaagtccatggtcttcgatttcaccaccaagtggcag
ctgcagctcgccgtggagcggagcgagtactggcgcctcgtcgactctcaaggaaagccc
ataggggcgatcggatggtggccccagatgtcggtcacgtttatcgataatcacgatacc
ggtccctctcccggcggtgggcagaacctctggcccttcccgtccgacaaggtggaagag
ggatacgcctacatcctcacccatcccggtgttccctgcgtgtattggccccacttcttc
gactggggaagcgacctcaggaacaagatcagcaccctcatccagataaggcgtaacaag
ggtatcacttccacgagttcggtcgacgtgctcgccgccgactcggggaagtacgtggcc
cgtatagacgatgtactcatcgtgaagatagggccggatctgtcctacaacccctcttcg
gagtggaccctcaccgcctacgggaacgactgggccgtgtggacaaaagagtag

DBGET integrated database retrieval system