KEGG   Spirochaeta thermophila DSM 6192: STHERM_c16130Help
Entry
STHERM_c16130     CDS       T01315                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
sta  Spirochaeta thermophila DSM 6192
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sta00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    STHERM_c16130
Enzymes [BR:sta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     STHERM_c16130
Exosome [BR:sta04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   STHERM_c16130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1774447..1775418)
Genome map
AA seq 323 aa AA seqDB search
MLPLRALRRDEATRDRIAETAWSRDQLIQALFVTTESKGKEPVPGFPGVYRHGLESLLHE
AEALLDAGIRKVLLFGVVPPSYKDETASWALRADGPVPTAVRELKRRFPELEVFTDVCVC
GYTSHGHCGLVRGGEVRNDESVVLLARMAAVHGEAGADWVAPSAMMDGQVEAIRRALDGR
GLSRVRILSYAAKYASRLYGPFREAAGSAPAFGDRRSYQMDVRNGAEAVVEVWADLVEGA
DAVMVKPALFYLDVIQRVRAAFPRVRLAAYLVSGEYAMLVRAEEEGSVPGAFREAVTAVF
RAGADLLITYDTRRIASWEEDHG
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgctacctcttagagccttaagaagggatgaggccacgagagatcggattgcagagacc
gcgtggtcgagggaccagctcatccaggcgctcttcgtgaccaccgagagcaaggggaag
gagcccgttcccggcttcccgggggtctatcgccatggcctcgagagcctcctccacgag
gcagaggccctgctggatgccgggatccggaaggtgctcctcttcggcgtggtgcccccc
tcgtacaaggacgagacggcctcgtgggcccttcgggcggatgggcctgtccccacagcg
gtccgcgagctcaagcggcgattccccgaactggaggtcttcaccgacgtgtgcgtatgt
ggctacacctcgcacggccactgtggcctcgtgcgtgggggggaggtgcgcaatgacgag
agcgtggtcctcctcgcccggatggccgcggtccatggagaggcgggggcggactgggtg
gcgccgtccgccatgatggacggtcaggtcgaggcgatacgcagggccctcgacgggaga
ggactgtcccgggtaaggatcctctcctatgcggcgaagtacgcctccaggctctacggc
cccttcagggaggcggccggatcggctccggcctttggagacaggcgctcctaccagatg
gacgtgcgcaacggggccgaggccgtggtggaggtgtgggccgacctggtggagggggcc
gatgcggtcatggtgaagccggccctcttctatctggacgtcatccagagggtgcgggcg
gcctttccccgcgtgaggctcgcggcctacctcgtctcaggggagtacgccatgctcgtg
cgtgcggaggaggaggggagtgtccccggggccttcagggaggcggtgaccgcggtcttc
cgtgcaggggccgatcttctcatcacctacgacacacgccgtatcgcctcatgggaggaa
gaccatggctag

DBGET integrated database retrieval system