KEGG   Spirochaeta thermophila DSM 6192: STHERM_c16290Help
Entry
STHERM_c16290     CDS       T01315                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
sta  Spirochaeta thermophila DSM 6192
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sta00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    STHERM_c16290
   00051 Fructose and mannose metabolism
    STHERM_c16290
Enzymes [BR:sta01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     STHERM_c16290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1789644..1790966)
Genome map
AA seq 440 aa AA seqDB search
MINEFFKNISKIPYEGPGSDNPLAFKYYNPDEVIGGKPLKEHLRFALAYWHTLNGSGQDP
FGVGTMIRPWLSISDPMEQAKARMRACFEIAEKLEIPFFCFHDRDIAPEGTTLRETNKLL
DEVVEYTKDLMKDSPVKLLWGTANLFSHPRYVHGASTSPNAEVFAYAAAQVKKALEVTLY
LGGQNYVFWGGREGYETLLNTNMQLELDNLARFLHMAVDYAKKIGFKGQFLIEPKPKEPT
KHQYDFDVAAVYGFLKKYDLLPYFKVNIEMNHATLAYHTFQHELHFARINGILGSMDVNQ
GDYLLGWDTDQFPTNLYETTLAMYEVIKNGGIAPGGLNFDAKVRRGSFEPEDIFIAHIAG
MDAFARGFKVAWKLLEDKAIEKHVEERYASYREGIGKKIVEGKVGFEDLEAYIIDKAEIK
NASGRQELLEAVLNRYLLEA
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgatcaatgaatttttcaagaacatctcaaagatcccctacgagggaccgggatccgat
aatcccctcgcgttcaagtactacaaccccgacgaggtgatcggtggcaagccgctcaag
gagcacctccgtttcgccctagcctactggcacaccctcaacgggagcgggcaggacccc
ttcggggtgggaaccatgatccgtccgtggctctcgatctccgatcccatggagcaggcc
aaggccaggatgcgggcctgtttcgagatcgcggagaagctggaaatccccttcttctgc
ttccacgacagggacatcgcacccgaggggaccacgctcagggagaccaataagctcctg
gacgaggtggtcgaatacaccaaggacctcatgaaggacagccctgtgaagctcctgtgg
ggaaccgcgaacctcttcagccatccgcgctacgtacatggggcatccacctcgcccaac
gccgaggtcttcgcctatgcggcggcccaggtcaagaaggcgctcgaggtgaccctgtac
ctgggcggccagaactacgtgttctggggcggtcgtgaagggtacgagaccctgctcaac
acgaacatgcagctcgagctcgacaacctcgcccgcttcctccacatggcggtggactac
gccaagaagatagggttcaaggggcagttcctcatcgagccgaagcccaaggagcccacc
aagcaccagtacgatttcgacgtggctgcggtgtacggattcctcaagaagtacgacctc
ctgccctacttcaaggtgaacatcgagatgaatcatgcgaccctggcctatcacaccttc
cagcacgaactccacttcgcccggatcaacgggatcctggggagcatggacgtcaaccag
ggggactacctcctcggatgggacaccgatcagttccccacgaacctctatgagaccacc
ctggcgatgtacgaggtgatcaagaacggcgggatcgctccgggcgggctcaacttcgac
gccaaggtgcggcggggatccttcgagcccgaggatatcttcatcgcccacatcgccggc
atggatgcctttgcacgggggttcaaggtggcctggaagctcctcgaggacaaggccata
gagaagcacgtggaggagcggtacgcgagctatcgtgagggcatcggcaagaagatcgtc
gagggcaaggtgggattcgaagatctcgaagcctatatcatcgacaaagcagagataaag
aacgcctccggcaggcaggagctcctggaggccgtcctcaaccggtacctgctcgaggcc
tga

DBGET integrated database retrieval system