KEGG   Spirochaeta thermophila DSM 6192: STHERM_c17550Help
Entry
STHERM_c17550     CDS       T01315                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase (EC:6.3.2.-)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
sta  Spirochaeta thermophila DSM 6192
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:sta00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:sta00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1919428..1920939
Genome map
AA seq 503 aa AA seqDB search
MSLVLSSLLDAIKPEEVRGGGDPRVRLLAYDSRDVESGALFFALPGLHTDGHRFVEDALG
RGAVAVVHERELPSYREGVVYLRVKNARRALSAASAVFYGHPSQDLEVTGVTGTDGKSST
TYFIYQLLRASGVKVGCISTALFSTGGEPEPNPLRQSTPEAPFVHGALARMREAGCTHAV
VEATSHGLSPRTARLEDVRFTVGVLTNITHEHMEFHGSFEQYREDKGRLFRGLPEGGKAV
LNLDDPSSGFLAERTRAGVWGYGLGTREGARLWAEVREESLAGSRCLVHGRETLEVWVPF
PGRFNVENVLAAVLGAAAAAGKEPEGFLSHVPHLEGVPGRMERVEAGQPFLVLVDYAHTP
GAFEKLLPFVRRFVEGRLIVVFGSAGERDRTKRPMQGRVASRWAEVVVLTDEDPRGEDRM
AILREIAAGCEGLVEGESLFMVPDRREAIGLAVGMAREGDAVLCLGKGHERSIVTAEGPV
AWDEVGAVREALAARGWREEQGL
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgagtctggttctatcatctttgctggatgcgatcaagcccgaggaggtgcggggcgga
ggggatccccgggtgcgtctcctcgcctacgattcgcgggacgtggaatcgggggcgctc
ttcttcgcccttccggggcttcacaccgacggacacaggttcgttgaggatgcgctcggg
cggggtgcggtcgcggtggtacacgagcgggagcttccgtcctaccgggaaggggtggtg
tacctgagggtgaagaacgcccggagggcgctctccgccgcttccgcggtgttctacggg
catccttcccaggatctcgaggtgacgggggtgacgggtacggacgggaagagcagtacc
acctacttcatctaccagctcctccgggcttcgggagtgaaggtggggtgcatctccacg
gcgctcttctccaccgggggggagcccgagccgaatccgcttcgccagtccacgcccgag
gccccgttcgtgcatggggcgctggcccgtatgagggaggcggggtgcacccacgcggtg
gtggaggcgacctcccacgggctctctccgcgcacggcacggctggaagacgtgcgcttc
accgtgggggtgctcaccaacatcacccacgagcacatggagttccacgggtcgttcgag
cagtaccgcgaggacaagggcaggctcttcagggggctccccgagggggggaaggcggtg
ctcaacctggacgatccttcctcagggttcctcgccgagaggacgagggccggggtgtgg
gggtacgggcttggtacacgggagggggcgaggctctgggccgaggtgcgggaggagtcg
ctcgcagggtcgcggtgtctcgtgcacgggagggagaccctcgaggtgtgggtgccgttc
ccgggccgcttcaatgtggagaacgtgctcgcggcggtgctgggggccgcggcggcggcg
gggaaggagccggaggggttcctgtcccacgtgccacacctcgagggtgtaccgggccgg
atggagcgggtggaggcaggtcagccgttcctcgtgctggtggattatgcccacacgccg
ggggcgttcgagaagctcctgccgttcgtgcgccggttcgtggaggggcgcctgatcgtg
gtcttcggatcggcgggcgagcgggacaggacgaagcggccgatgcaggggcgggtggcc
tcgcgctgggcggaggtggtggtgctcacggatgaggatccccggggcgaggacaggatg
gcgatcctgcgggagatcgccgcggggtgcgaggggctggtggagggtgagagcctgttc
atggtgccggaccgcagagaggcgatcggcctggcggtggggatggcgcgcgagggggat
gcggtgctgtgcctggggaagggccacgagcggagcatcgtcacggcggagggtccggtg
gcgtgggatgaggtgggggcggtacgggaggcactggcggcgcgggggtggcgggaggag
cagggcttgtga

DBGET integrated database retrieval system