KEGG   Spirochaeta thermophila DSM 6192: STHERM_c17680Help
Entry
STHERM_c17680     CDS       T01315                                 

Definition
xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
sta  Spirochaeta thermophila DSM 6192
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1936095..1937450)
Genome map
AA seq 451 aa AA seqDB search
MKRVVQVLMAGLLLLLGVMVSCELGSPIEGISSDVLSRAPDTGSKFLGNIFYGAEEPLKF
SQYWNQVTPENAGKWGSVESSRDQMNFGTLDYIYNYAKQHGMPFKFHVLVWGQQQPSWIS
GLSTSEQRAEVEEWFAAVADRYADIDMIDVVNEPLHSPPPYRDALGGDGSTGWDWVITSF
QLAREYFPDSTLLINEYGIISDPSAAQRYIQIIDLLTARGLVDGIGIQCHAFNMDSVSVS
TMEQVLDMLAQTGLPIYVSELDMRGDDQTQLQRYQEKFPVLWEHPSVRGVTLWGYVEGHI
WQSEAYLLHSDGTERPALSWLMQYVSGGSTPTPTPTPTPTPTPTPTPTPTPTPTATPTPT
PTSTPGGGEYTEIALPFSYDGAGEYYWKTDDFSTTTNWGRYVNSWNLDLLEINGTDYANT
WVPQHAIPPASDGYWYIHYKGSYPWSHVEMN
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgagtggtacaggtgctcatggcaggccttctcctcctccttggggtgatggtc
tcctgtgagctcggaagcccgatcgaagggatttcctccgatgtgctctcccgtgcgccc
gatacggggagcaaattcctcggcaacatcttctacggtgccgaggagccgctgaagttt
tcgcagtactggaaccaggtgacccctgagaatgcggggaagtgggggtcggtggagtcg
agccgggatcagatgaacttcggtacactcgactacatctacaactatgcgaagcagcac
gggatgccgttcaagtttcacgtgctcgtgtggggtcagcagcagccctcgtggatcagc
gggctttcgacgagcgagcagcgtgcggaggtggaggagtggtttgcggccgtggcggac
cggtacgccgacatcgacatgatcgacgtggtgaacgagccgctgcactcgccgccgccg
taccgtgatgcccttggtggtgatgggagcaccggttgggactgggtgatcacctcgttc
cagcttgcgagggagtactttccggacagcaccctgctcatcaacgagtacgggatcatc
tccgatccgagtgcagcgcagcggtacatccagatcatcgatcttctcacggcgcgaggg
cttgtggacgggatagggattcagtgtcacgccttcaacatggatagcgtgagcgtgtcc
acgatggagcaggtgctcgacatgcttgcgcagacgggtcttcccatctatgtgtccgag
ttggacatgaggggtgacgatcagacgcagcttcagcggtaccaggagaagtttccggtg
ttgtgggagcatccctcggtgaggggtgtgacgctctgggggtatgtggagggacacatc
tggcagagcgaggcgtacctgctgcactccgacggcacggagcggcccgccctctcctgg
ctcatgcagtacgtgagcggtggttccacacccacacccacacccacacccacacccaca
cccacgccgactccgacccccactcccacaccgacgcctacggccacccccacccccaca
cctacttctacgcccggtggaggtgagtataccgagatcgcccttcccttcagctacgac
ggggcgggtgagtactactggaagacggacgacttctccaccaccaccaattggggccgg
tatgtgaactcctggaacctcgatctcctcgagatcaacggtaccgactatgccaatacc
tgggtgcctcagcatgccatcccgcctgcctccgatggctactggtacatccactacaag
ggctcctatccgtggagccacgtggagatgaactag

DBGET integrated database retrieval system