KEGG   Spirochaeta thermophila DSM 6192: STHERM_c18380Help
Entry
STHERM_c18380     CDS       T01315                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
sta  Spirochaeta thermophila DSM 6192
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sta00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2012625..2013530)
Genome map
AA seq 301 aa AA seqDB search
MRAPSACLWYTAPMKALRLASGALLPYERRPLIMGIVNTTPDSFYPGSRASGEEAVRRAV
ALVEEGADLLDIGAESSRPGSDYVSEEEELARLVPVVREVRRLVDVPISVDTRKARVARE
ALDAGADIVNDISALRDDPDLARLVAERGVPVVLMHMRGTPRTMQIDPHYDDPVEEVRRE
LLSFVEHALEAGVHRDQIIIDPGFGFGKRREDNLLLLKHLDVFVSTGYPVLVGVSRKSFI
GLTLGREVEERLSGTLACHYHAALKGAAILRVHDVKATRDLILMKEAVEGATLPSGPAAE
S
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgcaccttccgcgtgtttgtggtatactgcccccatgaaagccctcagactcgca
tctggagccctccttccatacgaacgacggccgctcatcatgggcatagtgaacacgacg
ccggattccttctatcccggaagcagggcctccggtgaggaggcggtgaggagggccgtg
gccctcgtggaggagggggcggatctcctggacataggggccgagtcctcgcgtcccggg
agcgactatgtctccgaagaggaggaactcgcccggctcgttcccgtggtccgggaggtg
aggaggctcgtggacgtgccgatctcggtggatacccggaaggcccgtgtggcccgggag
gccctcgatgcaggggccgacatcgtgaacgacatctcggccctcagggacgatcccgac
ctcgcacggctcgtcgcggagaggggggtgccggtggtgctcatgcacatgcgcggaaca
ccccgcacgatgcagatcgatcctcactacgacgatccggtggaggaggtgcggagggag
ctcctctcgtttgtggaacacgccctcgaggcaggggtgcaccgcgaccagatcatcatc
gacccgggattcgggttcgggaaacgaagggaagacaacctcctgctcttgaagcacctg
gatgtattcgtctccaccgggtatcctgtgctcgtgggagtctcccgcaagtccttcatc
ggactcaccctggggagagaggtggaggaaagactctccggtaccctcgcgtgccactac
cacgccgccctcaaaggagcggccatcctcagggtgcacgatgtcaaggccacgagggat
ctcatcctcatgaaggaggccgtggaaggagcgacgctcccctccgggcctgcggcggag
tcatga

DBGET integrated database retrieval system