KEGG   Spirochaeta thermophila DSM 6192: STHERM_c18760Help
Entry
STHERM_c18760     CDS       T01315                                 

Definition
tryptophan synthase beta chain 2 (EC:4.2.1.20)
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sta  Spirochaeta thermophila DSM 6192
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sta00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    STHERM_c18760
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STHERM_c18760
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    STHERM_c18760
Enzymes [BR:sta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     STHERM_c18760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2057299..2058651)
Genome map
AA seq 450 aa AA seqDB search
MQRKILLSEKDLPSHWYNILADLPGGPLDPPLHPVTKQPLAPDELSALFPRALIEQEMSG
ERWIEIPEEVRKILALWRPTPLYRAYQLEQALGTPARIYFKWEGASPPGSHKSNTSVAQA
YYNRKEGITRLTTETGAGQWGSSLAFAGRLFGMEVRVYMVKVSYEGKPYRRIMMETWGAE
CIPSPSPRTKVGKAILEKDPDSPGSLGIAISEAVEEAVEREDTHYALGSVLNHVLLHQTV
IGLECKKQLELAGDYPDVVIGCVGGGSNFGGIALPFAYDKIHGKDVRLVAVEPSACPTLT
KGVYTYDYGDTGKMTPIVRMHTLGHDFVPPGIHAGGLRYHGMAPIVSRLVKEGVVEARAY
HQRAVFEAAVLFARTEGFIVAPETAHAIKACVDEALAAKEEGKERVILVNASGHGHFDMA
AYQQYFEGRLEDYEYPEEKIREALSALPRI
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagaaaaatcctgctcagtgaaaaggatcttccctcgcactggtacaacatcctc
gcggatctgccgggcgggccgctcgacccgcccctccatccggtcacgaagcagccgctc
gcgccggatgaactctccgccctcttcccccgggccctcatcgaacaggagatgagcggc
gagcggtggatcgaaattcccgaggaagtgcggaagatcctcgccctctggcggcccacg
ccgctctaccgggcctaccagctggaacaggccctcgggaccccggctcgtatctacttc
aagtgggagggtgcctctcctccgggttcccacaagtccaatacctcggtggcccaggcc
tactacaacaggaaggaagggatcaccaggctcaccacggagacgggggcgggccagtgg
gggagcagcctcgccttcgcgggcaggctcttcgggatggaggtgcgggtctacatggtg
aaggtgagctacgagggcaagccctacaggcgcatcatgatggagacgtggggcgccgag
tgcatacccagtccctcaccccgcaccaaggtgggcaaggccatcctcgagaaggatccc
gactcgcccggttccctcggtatcgccataagcgaggccgtggaggaggcggtggaacgg
gaggacacccactacgccctcggttcggtcctcaaccatgtgctgctccatcagacggtg
atcggcctcgagtgcaagaaacagctcgagctcgcgggtgactatcccgatgtggtcata
ggctgtgtgggtgggggatcgaacttcgggggtatcgcccttcccttcgcctacgacaag
atccatgggaaggacgtgcgcctcgtggcggtggagccttcggcgtgtcccaccctcacc
aagggcgtctatacgtacgactacggcgacacggggaagatgacccccatcgtcaggatg
cacaccctggggcacgacttcgtcccgccgggcatccatgcaggaggcctgcggtatcac
ggcatggcgcccatcgtctcgcgtctggtgaaggagggggtggtcgaggcccgtgcctac
catcagagggcggtcttcgaggccgcggtcctcttcgcccgcaccgaggggttcatcgtg
gcgcccgagacggcccatgcgatcaaggcctgcgtggacgaggccctcgcggcgaaggaa
gaagggaaggagcgggtcatcctggtgaacgcatcgggtcacgggcacttcgacatggcg
gcctaccagcagtacttcgagggcaggctcgaggattacgagtatcccgaggagaagatc
agggaggcactctcggcgctcccccggatctga

DBGET integrated database retrieval system