KEGG   Streptococcus pasteurianus: SGPB_0145Help
Entry
SGPB_0145         CDS       T01524                                 

Definition
beta-glucosidase (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
stb  Streptococcus pasteurianus
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:stb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGPB_0145
Enzymes [BR:stb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SGPB_0145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(148055..149455)
Genome map
AA seq 466 aa AA seqDB search
MATYTFPENFWWGAATSGPQSEGRFDKKHANMFDYWYEIEPETFYDQVGPDTASNFYNSY
KEDIALMKKVGLNSVRTSIQWTRLIDDLETNTVNQDAVDFYNNVIDCFIENGIRPIMNLH
HFDLPVELYHKYGGWESRHVVDLYVGFAEQAFKAFGDRVKDWATHNEPMVVVDGEYLYQF
HYPKLVDGKKAVQVAYNLNIASAKAIAKFRELGLDKDGGRIGTILNLTPTYAASDSEDDQ
AAAHFAELWNNKMFLEPAINGHFPEELEAVLEKDGVIWQTEPEDAEIFKNNTVDFLGVNF
YHPNRVKAPDIAPNSVGAWLPSRYYDEYNMPGRRMNIDKGWEIFPEAIYDIAINIRDNYK
NIPWFVSENGMGVSREERFMDESGQVQDDYRIDFIKEHLACLHRGIEEGSNCFGYHLWTP
IDCWSWMNAYRNRYGFISNNIHTQIKTIKKSGEWFKHVTVDNGFEE
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggcaacttacacattcccagaaaacttttggtggggcgctgctacatctggtcctcaa
agcgaagggcgtttcgataagaaacacgctaatatgtttgactattggtatgaaattgaa
cctgaaactttttatgatcaagtagggcctgacacagcctctaacttctataacagttat
aaagaagatattgcattgatgaaaaaagtaggactcaatagtgttcgtacttctattcaa
tggacacgtcttattgatgaccttgaaacaaatactgtcaaccaggatgcagtagatttc
tataataacgttattgattgcttcatcgaaaatggtattcgtccaatcatgaaccttcac
catttcgatttacctgttgaactttatcataaatatggtggttgggaatcacgccatgtt
gttgatctttacgttggatttgctgaacaagctttcaaagcattcggtgaccgcgttaaa
gattgggcaacacacaatgaaccaatggttgttgttgacggtgaatatctttaccaattc
cattatccaaaattagtcgatggtaagaaggcagttcaagttgcgtataacttgaatatt
gcttccgcaaaagctatcgctaaattccgagaacttggcttagacaaagatggggggcgc
attggtactattttgaacttaacaccaacttacgccgcctctgattctgaagatgaccaa
gcggcagcacactttgctgaactttggaacaacaaaatgttccttgaaccagctatcaac
ggacatttcccagaagaattagaagctgtattagaaaaagatggtgttatctggcaaaca
gaacctgaagatgctgaaatcttcaaaaacaacactgttgatttcttgggtgttaacttc
taccatccaaatcgtgtgaaagctccagacatcgcgcctaactctgtcggtgcttggttg
ccaagtcgttactatgacgagtacaacatgcctggtcgtcgcatgaatattgataaaggc
tgggaaatcttcccagaagctatttacgatattgccatcaacattcgcgacaactacaaa
aacatcccttggtttgtttctgaaaatggtatgggtgtttctcgtgaagaacgcttcatg
gacgaaagcggacaagttcaagatgattatcgtattgacttcatcaaagaacacctcgct
tgtctccaccgaggaatcgaagaaggttcaaactgtttcggttatcacctctggacacca
atcgattgctggtcttggatgaatgcttaccgcaaccgttatggatttatttcaaacaat
attcacacacaaattaagaccattaaaaaatctggcgaatggtttaaacacgttactgtt
gataatggatttgaagaataa

DBGET integrated database retrieval system