KEGG   Streptococcus pasteurianus: SGPB_0154Help
Entry
SGPB_0154         CDS       T01524                                 

Gene name
galA.1
Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
stb  Streptococcus pasteurianus
Pathway
Galactose metabolism
Glycerolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:stb00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:stb00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
157653..159884
Genome map
AA seq 743 aa AA seqDB search
MILINEEELSFHLTNGKVSYVFRVMERTGVLEQLYCGPAISDYESFTFLIEREIRPGNNL
YMGSSLMSLEHIKQEYPVFGTTDFRYPALEIQYPTGDLISHFRYVGYRIEKGKTVTGALP
GTFGNEEDVETLIVCLKDDYADLELELHYAIYANYPIITRQQKIINKDTQTVSIKRFASF
SLDLPNENYDWVHLDGAWARENHLSRSSIQKGIQNISSTRGHSSHVHNPFLAICSPEATE
NNGQVYGFSLIYSGSFLAQIELDNYNTLRIQMGINPFQFDWQLYPGQLFESPEAVLVVNQ
SGFNGMSQVFHDFYKEHLIRSSWKNKKRPVLLNSWEAMYFDFNQEKILEVAEEASKLGIE
LFVLDDGWFGKRNSDTGSLGNWTENKEKLPDGLAYLAKAIKEKGMLFGLWFEPEMVSDDT
DLFKEHPGWVIGNPEKNISHGRNQFVLDFGNPEVVEAIYNQMARLLSTVPIDYIKLDMNR
YISESFSSHLPSKQQGEVNHRYILGVYSLYEKLNQAFPDVLIESCAGGGARFDPGMLYYS
PQIWTSDDTDAVERLTIQWGTSMVYPLSTMSAHVSAVPNHQVARVTSLDMRKDVAMFGVF
GYELNPLALTEEEKEAVKAQIKEYHTYQELIQNGIFYRLDLMDKNHVGWLVVNKERTEAL
VGYYTILAQPNPIYERLKLVGLDPDKAYHILGKDKDEVRYGRDLTSIGIVLGKNYISREN
EYWSREMPGDFNGKIYYLQQIDK
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgattctcattaatgaggaagaactttcttttcatttgaccaatggaaaagtatcgtat
gtgtttagagtaatggagagaacaggggttttagagcaattatattgcggacctgccatt
tctgattacgaatcgtttacctttttgattgagcgtgaaattcgcccaggaaataatctt
tatatggggtcgagcttaatgtcgcttgagcatattaagcaagagtatcccgtatttggg
acgacggattttcgctatcctgctttagaaattcaatatccgacgggagatttgatttca
cattttcgctatgtgggctatcgtattgaaaaaggaaagacggtaacgggtgctcttcca
gggacttttggaaatgaagaagatgttgaaacgttgattgtttgtttgaaagatgactat
gctgatttagagcttgaattgcattatgcgatttatgcgaattatcctatcattacgcgt
cagcaaaaaatcattaacaaggacacacaaacggtctcgattaaacgttttgctagtttt
agtttagaccttccaaatgagaattatgactgggttcatttagatggtgcttgggcacgt
gaaaatcatttgtcgcgtagttccattcaaaaaggtatccaaaatatttcaagcacgaga
gggcacagcagtcatgttcacaaccctttccttgccatttgttcaccagaagcaaccgaa
aataatggacaagtatatggctttagtttgatttatagtggaagctttttagcccaaatt
gaattagacaactacaataccctacgcatacaaatgggtatcaatcccttccagtttgat
tggcaactttatccaggacaactgttcgaatctcctgaagctgtcttggttgtgaaccag
tcgggctttaatgggatgagtcaggtttttcatgatttttataaagaacatttaatacga
agttcatggaaaaataaaaaacgccctgttttactaaatagttgggaggcgatgtatttc
gattttaatcaagaaaagattttagaagtggctgaggaagccagtaaattaggaattgaa
ctttttgtcttggacgacggttggtttggcaagcgaaatagtgacacgggttcacttggt
aattggacggaaaacaaagaaaaattaccagacggacttgcttatttagctaaggctatc
aaagaaaaaggaatgttatttgggctttggtttgagccagaaatggtctctgatgatact
gatttgtttaaagaacatccaggttgggtcattggcaatccagaaaaaaacatttcgcat
ggtcgtaatcaatttgtgcttgattttggcaatccagaagtggtcgaagcaatttacaat
caaatggcacgtttgttatcaacggtgccgattgattacattaagttagacatgaaccgc
tacatttcagaaagtttttcaagtcatttgccaagtaaacagcaaggtgaggttaaccac
cgttacatcttgggtgtttacagcttatacgaaaaactaaatcaggcatttcctgatgtt
cttattgaatcttgtgcgggtggcggggcacgttttgaccctggaatgctttattattcg
ccacaaatctggacaagcgatgatacggacgcggtggaacgtttgactattcaatggggg
acttctatggtctatccgttatcaaccatgagtgcccatgtttcagcggtgcctaatcat
caagtcgcacgtgtgacatcacttgatatgcgaaaagacgttgccatgtttggtgtcttt
ggctacgaattaaatccattagctttgacagaagaggaaaaagaagctgtaaaagcgcag
attaaagaataccatacctatcaagaattgattcaaaatggtattttctatcgcttggat
ttgatggacaaaaaccatgtcggctggctggttgtcaataaagaaagaacagaagctttg
gttggctattatacgattttggcgcaaccaaatccaatttacgaacgtttaaaattagtt
ggtctcgaccctgataaagcctatcatattctcggaaaagataaagacgaggtaaggtat
ggacgtgacctaacttctatcggtattgttttaggaaaaaattatatcagtagagaaaat
gagtattggtcgcgcgaaatgccgggtgattttaacggaaaaatttattatttgcaacaa
attgataaataa

DBGET integrated database retrieval system