KEGG   Streptococcus pasteurianus: SGPB_0154Help
Entry
SGPB_0154         CDS       T01524                                 

Gene name
galA.1
Definition
(GenBank) alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
stb  Streptococcus pasteurianus
Pathway
stb00052  Galactose metabolism
stb00561  Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:stb00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SGPB_0154 (galA.1)
  Lipid metabolism
   00561 Glycerolipid metabolism
    SGPB_0154 (galA.1)
   00600 Sphingolipid metabolism
    SGPB_0154 (galA.1)
Enzymes [BR:stb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SGPB_0154 (galA.1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_36C Glyco_hydro_31 GHL10 Melibiase_2 XisH Terpene_synth
Motif
Other DBs
NCBI-ProteinID: BAK29290
UniProt: F5X4F0
Position
157653..159884
Genome map
AA seq 743 aa AA seqDB search
MILINEEELSFHLTNGKVSYVFRVMERTGVLEQLYCGPAISDYESFTFLIEREIRPGNNL
YMGSSLMSLEHIKQEYPVFGTTDFRYPALEIQYPTGDLISHFRYVGYRIEKGKTVTGALP
GTFGNEEDVETLIVCLKDDYADLELELHYAIYANYPIITRQQKIINKDTQTVSIKRFASF
SLDLPNENYDWVHLDGAWARENHLSRSSIQKGIQNISSTRGHSSHVHNPFLAICSPEATE
NNGQVYGFSLIYSGSFLAQIELDNYNTLRIQMGINPFQFDWQLYPGQLFESPEAVLVVNQ
SGFNGMSQVFHDFYKEHLIRSSWKNKKRPVLLNSWEAMYFDFNQEKILEVAEEASKLGIE
LFVLDDGWFGKRNSDTGSLGNWTENKEKLPDGLAYLAKAIKEKGMLFGLWFEPEMVSDDT
DLFKEHPGWVIGNPEKNISHGRNQFVLDFGNPEVVEAIYNQMARLLSTVPIDYIKLDMNR
YISESFSSHLPSKQQGEVNHRYILGVYSLYEKLNQAFPDVLIESCAGGGARFDPGMLYYS
PQIWTSDDTDAVERLTIQWGTSMVYPLSTMSAHVSAVPNHQVARVTSLDMRKDVAMFGVF
GYELNPLALTEEEKEAVKAQIKEYHTYQELIQNGIFYRLDLMDKNHVGWLVVNKERTEAL
VGYYTILAQPNPIYERLKLVGLDPDKAYHILGKDKDEVRYGRDLTSIGIVLGKNYISREN
EYWSREMPGDFNGKIYYLQQIDK
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgattctcattaatgaggaagaactttcttttcatttgaccaatggaaaagtatcgtat
gtgtttagagtaatggagagaacaggggttttagagcaattatattgcggacctgccatt
tctgattacgaatcgtttacctttttgattgagcgtgaaattcgcccaggaaataatctt
tatatggggtcgagcttaatgtcgcttgagcatattaagcaagagtatcccgtatttggg
acgacggattttcgctatcctgctttagaaattcaatatccgacgggagatttgatttca
cattttcgctatgtgggctatcgtattgaaaaaggaaagacggtaacgggtgctcttcca
gggacttttggaaatgaagaagatgttgaaacgttgattgtttgtttgaaagatgactat
gctgatttagagcttgaattgcattatgcgatttatgcgaattatcctatcattacgcgt
cagcaaaaaatcattaacaaggacacacaaacggtctcgattaaacgttttgctagtttt
agtttagaccttccaaatgagaattatgactgggttcatttagatggtgcttgggcacgt
gaaaatcatttgtcgcgtagttccattcaaaaaggtatccaaaatatttcaagcacgaga
gggcacagcagtcatgttcacaaccctttccttgccatttgttcaccagaagcaaccgaa
aataatggacaagtatatggctttagtttgatttatagtggaagctttttagcccaaatt
gaattagacaactacaataccctacgcatacaaatgggtatcaatcccttccagtttgat
tggcaactttatccaggacaactgttcgaatctcctgaagctgtcttggttgtgaaccag
tcgggctttaatgggatgagtcaggtttttcatgatttttataaagaacatttaatacga
agttcatggaaaaataaaaaacgccctgttttactaaatagttgggaggcgatgtatttc
gattttaatcaagaaaagattttagaagtggctgaggaagccagtaaattaggaattgaa
ctttttgtcttggacgacggttggtttggcaagcgaaatagtgacacgggttcacttggt
aattggacggaaaacaaagaaaaattaccagacggacttgcttatttagctaaggctatc
aaagaaaaaggaatgttatttgggctttggtttgagccagaaatggtctctgatgatact
gatttgtttaaagaacatccaggttgggtcattggcaatccagaaaaaaacatttcgcat
ggtcgtaatcaatttgtgcttgattttggcaatccagaagtggtcgaagcaatttacaat
caaatggcacgtttgttatcaacggtgccgattgattacattaagttagacatgaaccgc
tacatttcagaaagtttttcaagtcatttgccaagtaaacagcaaggtgaggttaaccac
cgttacatcttgggtgtttacagcttatacgaaaaactaaatcaggcatttcctgatgtt
cttattgaatcttgtgcgggtggcggggcacgttttgaccctggaatgctttattattcg
ccacaaatctggacaagcgatgatacggacgcggtggaacgtttgactattcaatggggg
acttctatggtctatccgttatcaaccatgagtgcccatgtttcagcggtgcctaatcat
caagtcgcacgtgtgacatcacttgatatgcgaaaagacgttgccatgtttggtgtcttt
ggctacgaattaaatccattagctttgacagaagaggaaaaagaagctgtaaaagcgcag
attaaagaataccatacctatcaagaattgattcaaaatggtattttctatcgcttggat
ttgatggacaaaaaccatgtcggctggctggttgtcaataaagaaagaacagaagctttg
gttggctattatacgattttggcgcaaccaaatccaatttacgaacgtttaaaattagtt
ggtctcgaccctgataaagcctatcatattctcggaaaagataaagacgaggtaaggtat
ggacgtgacctaacttctatcggtattgttttaggaaaaaattatatcagtagagaaaat
gagtattggtcgcgcgaaatgccgggtgattttaacggaaaaatttattatttgcaacaa
attgataaataa

DBGET integrated database retrieval system