KEGG   Streptococcus pasteurianus: SGPB_0178Help
Entry
SGPB_0178         CDS       T01524                                 

Gene name
galA.2
Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
stb  Streptococcus pasteurianus
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:stb00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SGPB_0178 (galA.2)
  Lipid metabolism
   00561 Glycerolipid metabolism
    SGPB_0178 (galA.2)
   00600 Sphingolipid metabolism
    SGPB_0178 (galA.2)
Enzymes [BR:stb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SGPB_0178 (galA.2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
183067..185229
Genome map
AA seq 720 aa AA seqDB search
MGITIKGNLFYIQSKEMSMIIENREGDLLLRHIGGKIANYHGSNAIFEKDHAFSGNPTPD
NRTFSYDTQRQIFGVHGFGDFRCPSLKIQHDNNELTQFKLKDSHILHGVVEATGLPSPHS
MEGAETLVFILEDEFAKLRLTLYYTAYADRATISTFAKISNLSDKAVIINRALSTMLDVP
AGNYDVVTLQGAYAREKTVRRQMVEQGIFSIASNRGASGHAQTPAVILCDRTATEDAGSA
LALQLLYSGNFQAFVQKNQLNEVRLGIGINDDNFAWQLAARDNFETPVALMTYSAKGLTH
LSQESQLFVQNHIMPKQFAHAERPILINNWEATYFDFKKEKLLDLADEASKLGIELFVLD
DGWFGNRFDDNRALGDWVVNEEKLGGPLNDLIAEVHAKGLKFGLWFEPEMISVDSDLYRA
HPDWAIQAEGRGHTYSRNQLVLNLANPDVVAYIKAAIDKILTENTIDYVKWDYNRNITNI
GNGDTYLATQMQSHDYMLGLYDLVSYLTEKHSNILFESCSGGGGRNDLGMMRYFPQVWAS
DNTDAISRLPIQYGSSYLHPTISMGSHVSASPNHQMGRTTPIETRGNVAMMGNLGYELDL
KSLPQAEKDVIAAQVAHYKEIRPVIQFGKQYRLINPEEGSNEAAVQFVYEDKVVVTYVRT
LSTIEIIETTLKLKGLEEEALYCLQGTDQVYSGAELMYAGLIAILPQGDYLSKQYYFVKQ
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
gtgggaattacaatcaaaggaaatcttttctatattcagagtaaagagatgtcaatgatt
attgagaatcgagaaggtgatttacttcttcgtcatattgggggtaaaatcgctaactat
cacggttcaaatgcgatatttgagaaagatcatgctttttcaggcaatccgactcccgat
aatcgtacgtttagctatgatacccaacgtcaaatctttggtgtgcatggctttggtgac
tttcgttgcccatcacttaaaattcaacatgataacaatgaattaacacaatttaagtta
aaagatagtcatattttacatggagttgttgaggcaacaggattacctagtcctcattca
atggaaggtgctgaaacattagtgtttatcttagaagatgaatttgctaaattgcgtctg
acgctttattacacagcttatgcagatcgtgcaactatttcaacctttgctaagattagt
aatctatccgataaagctgttatcatcaaccgtgctttatcaactatgcttgatgtacct
gctggaaattatgatgtggtgactttgcaaggagcttatgcgcgtgagaaaacagttcgt
cgtcaaatggtcgagcaaggtatctttagcattgcttcaaatcgcggagcttctggtcat
gctcagactccagctgtgattttgtgtgataggacagcgacggaggatgctggcagtgcc
cttgctttgcagctactttatagtggtaattttcaagcttttgttcaaaaaaatcaattg
aatgaagttcgcttagggattggtattaatgatgataactttgcttggcaattggcagct
agagataattttgaaacgccagtggctttgatgacttattcggcaaaaggtttgacacac
ttgagccaagaaagccagttgtttgtgcaaaatcatatcatgccaaaacaatttgcacat
gctgaacgtccaattctcattaacaattgggaagcgacttattttgatttcaaaaaagaa
aaattgcttgatttagctgacgaagcaagcaaacttggtatcgagctttttgttcttgat
gacggttggtttggtaatcgatttgatgataatcgtgcgcttggtgactgggttgtcaac
gaagaaaaactcggtgggcctttgaatgacttgattgctgaagtgcatgccaaaggtttg
aaatttggtttgtggtttgaaccagaaatgatttctgttgatagtgatctttatcgtgcg
catccagattgggctattcaagctgaaggtcgtggtcatacttattctcgtaatcaattg
gtgctcaaccttgcaaatcctgatgtcgtagcctacatcaaggcagctattgataagatt
ttgacagaaaatactattgattatgttaaatgggattataaccgtaacatcacaaatatc
ggaaatggtgatacttatcttgcgacccaaatgcaatctcatgattacatgctaggtttg
tatgatttggtgtcttatttgacagaaaagcatagtaacattctctttgaatcttgctca
ggtggtggtggtcgaaatgaccttggtatgatgcgctatttcccacaagtttgggctagt
gacaatactgatgccatttcacgtttgccaattcaatacggctcaagttaccttcaccca
accatttcaatgggctctcacgtatcagcaagtcctaatcaccaaatgggacgcacaaca
ccgattgaaactcgcggtaatgttgccatgatgggaaatcttggctatgaacttgatttg
aaaagcttgccacaagctgaaaaagatgtaattgctgctcaagtcgctcattacaaagag
attcgtccagtgattcaatttggtaagcaatatcgcttgattaatccagaagaagggtca
aatgaagcagcggttcaatttgtttatgaagataaggtagttgtcacttatgttcgcaca
ctttcaaccattgaaatcattgaaacaacacttaagctgaaaggtttggaagaagaagct
ctttactgcttgcaaggaacagaccaagtttactcaggagcagagctcatgtacgcgggc
ctcatagcgattctcccacaaggtgattacctcagcaaacaatactatttcgtgaaacaa
taa

DBGET integrated database retrieval system