KEGG   Streptococcus pasteurianus: SGPB_0182Help
Entry
SGPB_0182         CDS       T01524                                 

Gene name
ycjM
Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
stb  Streptococcus pasteurianus
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:stb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SGPB_0182 (ycjM)
Enzymes [BR:stb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     SGPB_0182 (ycjM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
188347..189792
Genome map
AA seq 481 aa AA seqDB search
MTIQNKTMLITYSDSLGKNLKELNENLGKYFGEAVGGVHLLPFFPSTGDRGFAPVDYDEV
DAAFGDWDDVKALGEKYYLMFDFMINHISRQSKYYKDYQEKHEASAYKDMFLNWDKFWPE
NRPTQADVDLIYKRKDRAPKQGIHFADGSVEHLWNTFGEEQIDLDVTKDVTMDFIRKTIA
HLAENGCDLIRLDAFAYAVKKLDTNDFFVEPEIWELLDKVRSIAAESGTELLPEIHEHYS
IQFKIAEHDYYVYDFALPMVVLYSLYSGNVNRLAKWLKMSPMKQFTTLDTHDGIGVVDVK
DILTDEEIDYTSNELYKVGANVNRKYSTAEYNNLDIYQINSTYYSALGDDDKKYFLARLI
QAFAPGIPQVYYVGFLAGKNDLELLEKTKEGRNINRHYYSSSEIAEEVKRPVVQALLKLF
TFRNQSAAFALDGSIDVEILDENTLVITRRNQGSSVVAEAQINLKELSYAVKENGEEVTF
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgacaatacaaaataaaacaatgcttattacttactcagatagtctgggaaagaatttg
aaagaattaaatgaaaatcttggcaagtattttggagaagctgtcggcggggttcatctt
ttgccatttttcccgtcaacaggtgaccgtggttttgcgccagtcgattatgatgaggtt
gatgctgcatttggggattgggatgacgtgaaggcattgggtgagaagtattatctcatg
tttgatttcatgattaaccatatttctcgtcaatcaaaatattacaaagattatcaggaa
aagcacgaagctagtgcttacaaggatatgtttcttaactgggataaattttggccagaa
aatcgtccgacacaagctgatgtggatttgatttacaagcgtaaagaccgcgcaccaaaa
caaggaattcactttgcggacggttcagttgagcatctctggaacacatttggtgaagag
cagattgaccttgatgtgacaaaagacgtgaccatggatttcattcgaaagaccatcgcg
catttagctgaaaatggttgcgaccttattcgattagatgcttttgcttatgcagttaaa
aaattagatactaatgatttctttgtagaaccagaaatctgggaattgcttgataaagtc
cgcagcattgctgcggaatctggtacagagttgcttccagaaattcatgagcactattca
atccagtttaagatcgctgagcacgattactatgtttatgattttgcccttccgatggtg
gttctttatagcctttacagcggaaatgttaatcgtttggcgaaatggcttaaaatgtct
cccatgaaacaatttacgacacttgatacgcacgatggtattggagttgttgatgtcaaa
gatatcttgacggatgaggaaattgattacacgtcaaatgaactttataaagtaggtgcc
aacgtcaaccgaaaatattcaacagccgagtataataatcttgatatctaccaaatcaat
tcaacttactattctgcgcttggggatgatgacaagaaatatttcttagctcgtttgatt
caagctttcgcgccaggcattccacaagtgtattatgttggctttttagctggtaaaaat
gatcttgaattgttagaaaaaacaaaagaaggtcgcaatattaatcgtcattattatagc
agtagcgaaattgcagaagaagtcaaacgtccagttgttcaagctttgctaaaattattt
actttccgtaatcaatcggctgcttttgccctggatggcagtattgatgtagagatatta
gatgaaaatacgcttgtaatcactcgccgtaatcaaggtagcagtgtggttgcggaagcc
caaattaatttaaaagagttaagctacgcagttaaagaaaacggggaagaagttactttc
ttataa

DBGET integrated database retrieval system