KEGG   Streptococcus pasteurianus: SGPB_0206Help
Entry
SGPB_0206         CDS       T01524                                 

Gene name
adhE
Definition
bifunctional acetaldehyde dehydrogenase/alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
stb  Streptococcus pasteurianus
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:stb00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SGPB_0206 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGPB_0206 (adhE)
   00620 Pyruvate metabolism
    SGPB_0206 (adhE)
   00650 Butanoate metabolism
    SGPB_0206 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    SGPB_0206 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SGPB_0206 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SGPB_0206 (adhE)
   00626 Naphthalene degradation
    SGPB_0206 (adhE)
Enzymes [BR:stb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SGPB_0206 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SGPB_0206 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
215175..217856
Genome map
AA seq 893 aa AA seqDB search
MAKATNADVKNNELSAEEVAQQYTGALVDKALEAERVYATYSQEQVDKIVAAMALAGSEA
SLELAKEAHAETGRGVVEDKDTKNHFATEYVYERIKNEKTVGIIGEDRVSGSIQIAAPLG
VLAGIVPTTNPTSTTMFKILVALKTRNAIVFAFHPQAQKCSAHAAKILYDAAVKAGAPEN
IVQWIETPSIANTTALIQNKKIASILATGGPGMVNAALKSGNPSMGVGAGNGAIYVDATA
HIDRAVEDLLLSKRFDNGMICATENSAVVEAPIYKEWLQKMQDKGAYLVPKKDYKKIEDF
VFNDNHGVNGPVAGMPATWICEQAGVKLPEGKDVLLFELDKQNIGEKLSSEKLSPLLSVY
KAKDREEGIEIVEALLDYQGAGHNAGIQIGSQADPFVATYGDAVKASRVLVNQPDSVGGI
GDVYTDALKASLTLGTGSWGKNSLSHNLSTGDLLNIKTVAKRRNRPQWIRLPEKTYYEKN
AISYLQDEYEPMQRALIVADPGMVQFGFVDTVLAQLALRDEKVATSIYGTIKPDPTLGQT
IEIAKQMRDFKPDTVIAIGGGSAIDASKIARLIYEVYLDRGDEFLDSYDAVSEFFLELQQ
KFIDIRKRIVKFKHQTTTRLFCIPTTSGTGAEVTPFAVITDDYTHVKYPLADYELVPQVA
IVDPEFVMTVPKRTAAWSGLDALSHALESYVSVMASDFTRPWSLEAIKLIIENLEDAYNY
DPKNPTLRGEKAKENMHYAAAIAGMAFGNAFLGINHSLAHKTGGEFGLPHGLAISIAMQH
VIRYNAVSGNVKRSVYPRYEEYRAQKDYADIARYIGLKGKDDAELVEALCDRIDKLMHAV
DVEPKLSANGVTKEAFDAAVDRLASLAYDDQCTPANPRQPYISELKQLLIDMF
NT seq 2682 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagcaacaaatgcagatgtaaagaataacgagttgagcgctgaagaagtagct
cagcagtacacaggggctcttgtcgataaagctcttgaagctgagcgcgtttatgcaact
tattcacaagaacaagttgataaaattgtagcagctatggctctcgcaggttctgaagct
tcgctagaattggcaaaagaagcacatgccgaaactggtcgtggtgtcgttgaggataaa
gatactaaaaaccacttcgcaacagaatacgtttatgaacgtatcaaaaatgaaaaaaca
gttggcatcattggtgaagatagggtttctggaagtattcaaattgcagcccctctcggt
gttttagcaggtattgtcccaacaacaaacccaacatcaacaacaatgtttaaaattttg
gtggcgttgaaaacacgtaatgccattgtttttgcattccacccacaagcacaaaaatgt
tcagctcatgcagcaaaaattctttacgatgctgcggtgaaagctggtgctccggaaaat
attgtccaatggattgaaacaccatcaatcgctaacacaacagcccttatccaaaacaag
aaaattgcttctattttggcaactggtggacctggtatggtaaatgcagcccttaaatca
ggtaacccatcaatgggtgttggtgcaggtaatggtgctatctatgttgatgcaactgct
catattgaccgcgctgtggaagacttgttgttatcaaaacgctttgataatggtatgatt
tgtgcgactgaaaattcagcagtcgttgaagcgccaatttacaaggaatggttgcaaaaa
atgcaagataaaggtgcttacttagtacctaagaaggactacaagaaaattgaagacttt
gttttcaatgacaaccatggtgtaaacggtcctgttgccggaatgccagcaacttggatt
tgtgaacaagctggtgtgaaattgccagaaggcaaggacgttctcttgtttgaacttgac
aagcaaaacatcggtgaaaaactatcatcagaaaaattgtctccactcctttcagtgtac
aaagctaaagatcgtgaagaaggtatcgaaattgttgaagcgcttcttgattatcaaggt
gcaggacacaatgccggtatccaaattggttcacaagcagatccatttgtagcaacatat
ggcgatgccgtgaaagcatcacgtgtcttggttaaccaaccagattcagtcggaggtatc
ggtgatgtctatacagacgcacttaaagccagcttaacacttggaacaggatcatggggg
aaaaattcattgtcacacaatctttcaactggcgatctcttaaatatcaagactgttgcg
aaacgtcgtaaccgtccacaatggattcgcttaccagaaaaaacttactacgaaaagaat
gctatctcatatttgcaagatgaatatgaaccaatgcaacgtgctttaattgtagcagac
ccaggtatggttcaatttggatttgttgacactgtccttgctcaattggcattgcgtgat
gaaaaagtcgcaacatcaatttacggaacaatcaaaccagacccaactcttggacaaaca
atcgaaattgcaaaacaaatgcgtgatttcaaaccagatacagtcattgcaattggtggt
ggctctgctattgatgcatctaaaattgcacgtttaatttatgaagtttatcttgaccgt
ggtgatgaattccttgatagttatgatgctgttagcgaatttttccttgaattgcaacaa
aaattcattgatattcgtaaacgtattgtgaaattcaaacatcaaacaacaacacgcctt
ttctgtatcccaaccacatctggtacaggtgctgaggtgacaccatttgcggttattact
gatgattatacacacgtgaaatacccacttgctgattatgaattggtaccacaagttgct
attgttgatccagaatttgttatgactgtgccaaaacgtacagcagcttggtcaggatta
gatgctttgtcacatgctcttgaatcttacgtatcagttatggcatctgactttacacgt
ccatggtctcttgaagctatcaagttgattattgaaaatcttgaagatgcttataactac
gatcctaagaacccaacacttcgtggtgaaaaagctaaagaaaacatgcattatgcagca
gctattgctggtatggcatttggtaatgctttcttaggtatcaaccattcacttgctcac
aaaacaggtggtgaatttggacttccacacggtttagctatttcaatcgcaatgcaacat
gttatccgctataacgctgtatctggtaatgttaaacgctcagtttacccacgttatgaa
gaataccgtgctcaaaaagattacgcagatattgcgcgttatattggtcttaaaggtaaa
gatgatgcagaattagttgaagcactttgcgatcgcattgataaattgatgcatgctgtt
gacgttgaaccaaaactttctgctaatggtgttacaaaagaagcctttgatgcagcagtt
gatcgtttggcaagtttggcatatgatgaccaatgtactccagcaaacccacgtcaacca
tacatttcagaattgaaacaacttttgattgatatgttctaa

DBGET integrated database retrieval system