KEGG   Streptococcus pasteurianus: SGPB_0344Help
Entry
SGPB_0344         CDS       T01524                                 

Gene name
bga
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
stb  Streptococcus pasteurianus
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:stb00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SGPB_0344 (bga)
Enzymes [BR:stb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SGPB_0344 (bga)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
360548..362335
Genome map
AA seq 595 aa AA seqDB search
MKRFQIKESFFLDGKPFKILSGSIHYFRIHPDDWYQSLYNLKALGFNTVETYVPWNLHEP
REGEFDFTGILDLERFLTIAQELGLYAIVRPSPYICAEWEFGGLPAWLLEKGVRVRSQDK
DFLQVVKRYYEALIPRLIKHQLDQGGNILMFQVENEYGSYGEDKVYLRELKQMMLELGLE
EPFFTSDGPWHTALRAGSLIEDDVLVTGNFGSKAKENFASMEMFFQQYGKKWPLMCMEFW
DGWFNRWGEPVIKRDPEELADAVMEAIEIGSINLYMFHGGTNFGFMNGCSARKQTDLPQV
TSYDYDAILDEAGNPTKKFYILQHRLKNKYPELHYAAPLVKPTMAIKDIALSAKTNLVSV
LEDIGECHTSFYPQNMEALNQSTGYIFYRTKLNGYQGNTEKVRLIDTRDRAQVFLNGNHI
VTQYQEEIGDDIQVNFTSEESQLDILVENMGRVNYGHKLTAPSQHKGIGRGVMLDLHFVN
QWETYPLSMNSIKNLKYSSPWREGVPSFYEFKFHCLNPEDTYMDMSGFGKGVAFINGYNL
GRFWNIGPTLSLYIPRGMMVCGENTITIFETEGYYQETLNLCMEPNFKKIEGENL
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgttttcaaattaaagaatcgttctttcttgacggtaagccatttaagatctta
tctggttctattcactattttcgaattcatccagatgactggtatcagtcactttataat
ttaaaggctttgggattcaatacagttgaaacatatgtgccttggaatttacacgaacca
cgtgagggagaatttgattttactggtattttagacctagaaagatttttaacgattgca
caggagttaggactatatgctattgttagaccttcaccatacatttgtgctgaatgggaa
tttggtggtttaccggcatggctactggagaaaggagttagagttcgttcacaagataaa
gactttttacaggtagtgaaacgttattatgaagcattaattcctagattgattaagcat
caacttgatcaaggaggaaatattctgatgtttcaagttgaaaatgaatatggttcttat
ggtgaagataaggtttatttaagagaacttaagcagatgatgcttgaactaggcttggaa
gaacccttctttacctcagatggcccttggcatacggctctacgtgcaggaagccttatt
gaagatgatgttttagtaacaggaaattttggttctaaagcaaaagagaattttgcttct
atggaaatgtttttccagcaatatggtaaaaagtggcctctgatgtgtatggagttttgg
gatggctggtttaatcgttggggggaacccgtgattaaacgtgaccctgaggagttagct
gatgctgtcatggaagctattgaaataggaagcatcaatctttacatgtttcacggtggt
accaattttggttttatgaatggctgttccgctcggaaacagacagatttaccacaggtt
acttcatatgattacgatgctatattagatgaagcaggtaatccaacgaaaaaattctac
atattgcaacatcgtttaaaaaataaatacccagagttgcattatgctgcacctttagta
aagccaactatggctataaaggatattgctctttcagctaaaacgaatttagtttcagtt
cttgaagatatcggtgagtgtcatacgagtttttatcctcagaatatggaagctttaaat
cagtcaactggttatattttttatcgaactaagttaaatggttatcagggaaacactgaa
aaagtgagacttattgatacaagagatagagcacaagttttcttaaatggcaaccatatt
gttacccagtaccaggaagaaatcggagatgatattcaagttaacttcacttcagaagag
agtcaacttgatattttagttgaaaatatggggcgggtaaattatggacacaaattaaca
gcaccaagtcaacataaaggaatcggtcgtggtgtgatgcttgatttacattttgttaat
caatgggaaacttatcctttatctatgaattctattaagaaccttaagtattctagccct
tggcgagaaggagtaccaagtttttatgaatttaaatttcattgtttaaatccagaagat
acttatatggatatgtctggattcggaaaaggagttgccttcattaacggctataatctt
ggtagattttggaatattggaccaacattgtcactttatattcctaggggaatgatggtt
tgtggcgaaaatacgattactatttttgaaacagagggatattaccaagaaactctaaat
ctttgcatggagcctaatttcaaaaaaatagaaggagaaaatttatga

DBGET integrated database retrieval system