KEGG   Streptococcus pasteurianus: SGPB_0467Help
Entry
SGPB_0467         CDS       T01524                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
stb  Streptococcus pasteurianus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:stb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SGPB_0467 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGPB_0467 (glk)
   00052 Galactose metabolism
    SGPB_0467 (glk)
   00500 Starch and sucrose metabolism
    SGPB_0467 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    SGPB_0467 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SGPB_0467 (glk)
   00524 Butirosin and neomycin biosynthesis
    SGPB_0467 (glk)
Enzymes [BR:stb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SGPB_0467 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
486777..487745
Genome map
AA seq 322 aa AA seqDB search
MTKKLLGIDLGGTTIKFGILTLEGEVQEKWAIDTNILEDGKHIVPDIVGSIKHRLNLYGL
TKDDFVGIGMGSPGAVDRAKKTVTGAFNLNWAHTEEVGSVIERELGIPFAIDNDANVAAL
GERWTGAGANNPDVVFVTLGTGVGGGVIADGNLIHGVAGAGGEIGHMNVEPVDGFECTCG
NKGCLETVASATGVVRVARHLAEEYEGDSSIKAAIDNGDAVTSKDIFVAAEAGDHFADSV
VEKVGFYLGQATANIANILNPDSVVIGGGVSAAGEFLRSRVEKYFVSYAFPQVRKTTKIK
IAELGNDAGIIGAASLASQFVD
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaaacttttggggattgaccttggtgggacaacgattaaattcggtatccta
acacttgagggagaagtacaagaaaaatgggcaattgatactaatatccttgaagatggt
aaacacattgtccctgatattgttggatcaatcaaacaccgtttgaatctttacggtttg
acaaaagatgattttgtaggtatcggtatggggtctccaggtgctgttgaccgcgctaaa
aaaacagttacaggtgctttcaacttgaactgggcacacactgaagaagtcggttcagtt
atcgaacgtgaacttggcattccatttgctattgataacgatgcaaatgtagctgcactt
ggtgaacgttggacaggtgctggcgcaaacaatccagatgttgtttttgtaacacttgga
actggtgttggtggcggtgttatcgctgacggtaaccttatccatggtgtcgctggtgct
ggtggagaaattggtcacatgaatgttgagccagttgatggatttgaatgtacttgtggt
aacaagggttgcctagaaacagttgcttcagcgacaggtgttgtgcgtgtggctcgtcat
ttggctgaagaatatgaaggtgattcaagcatcaaagctgccattgataatggtgatgcg
gtgacaagtaaagacatctttgtcgctgctgaagcgggtgaccattttgccgattcagtt
gttgaaaaagttggtttctatcttggtcaagcaacagcaaatatcgcaaacatcttaaac
ccagactcagttgttatcggtggtggtgtttcagctgcaggcgaattcttgcgtagtcgc
gttgaaaaatattttgtcagctacgctttcccacaagtgcgcaaaacaacaaaaatcaaa
attgccgaacttggaaatgatgctggtatcattggtgcagcaagtcttgcaagtcaattt
gtagattaa

DBGET integrated database retrieval system