KEGG   Streptococcus pasteurianus: SGPB_0513Help
Entry
SGPB_0513         CDS       T01524                                 

Gene name
gpm.2
Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
stb  Streptococcus pasteurianus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:stb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SGPB_0513 (gpm.2)
   01230 Biosynthesis of amino acids
    SGPB_0513 (gpm.2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGPB_0513 (gpm.2)
  Energy metabolism
   00680 Methane metabolism
    SGPB_0513 (gpm.2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SGPB_0513 (gpm.2)
Enzymes [BR:stb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SGPB_0513 (gpm.2)
Exosome [BR:stb04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SGPB_0513 (gpm.2)
  Exosomal proteins of melanoma cells
   SGPB_0513 (gpm.2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
534240..534932
Genome map
AA seq 230 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDLAYTSVLKR
AIKTTNLALEAADQLWVPVEKSWRLNERHYGGLTGQNKAEAAEKWGDEQVHIWRRSYDVL
PPAMAKDDEYSAHTDRRYANLDDTVIPDAENLKVTLERALPFWEDKIAPALKDGKNVFVG
AHGNSIRALVKHIKQLSDDEIMDVEIPNFPPLVFEFDEKLNVTNEYYLGK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattggtttttgctcgccacggtgagtcagaatggaacaaagctaaccttttc
acaggttgggctgacgttgatttgtcagaaaaaggtacacaacaggcgatcgatgctggt
aaattaatcaaagaagctggtattgagtttgaccttgcttacacttcagttcttaaacgt
gctatcaaaacaactaaccttgctcttgaagcagctgaccaactttgggtaccagttgaa
aaatcatggcgcttgaacgaacgtcactacggtggtttaactggacaaaacaaagctgaa
gctgctgaaaaatggggtgacgaacaagttcatatctggcgtcgttcatacgatgtattg
ccaccagctatggctaaagatgacgagtactcagcacatactgaccgtcgttacgctaac
cttgacgatacagtaattccagatgctgaaaacttgaaagttactttggaacgtgctctt
ccattctgggaagataaaatcgctccagctcttaaagacggtaaaaacgtctttgtaggt
gcacacggtaattcaatccgcgctcttgtaaaacatatcaaacaattgtcagatgacgaa
attatggatgttgaaatccctaacttcccaccgcttgtattcgaattcgatgaaaaatta
aacgttacaaacgaatactaccttggtaaataa

DBGET integrated database retrieval system