KEGG   Streptococcus pasteurianus: SGPB_0658Help
Entry
SGPB_0658         CDS       T01524                                 

Gene name
murA.2
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
stb  Streptococcus pasteurianus
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:stb00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:stb00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
685403..686689
Genome map
AA seq 428 aa AA seqDB search
MEFVLDKIIIEGGNTRLQGEVVIEGAKNAVLPLLAATILPEEGKTILTNVPILSDVFTMN
NVVRGLNIQVDFDEANNKIEVDASGDILDIAPYEYVSKMRASIVVLGPILARNGHAKVSM
PGGCTIGSRPIDLHLKGLEAMGAKITQSGGDITATVDGKLKGTTIYMDFPSVGATQNLMM
AATLADGVTTIENVAREPEIVDLAMLLNKMGANVRGAGTETLTITGVDNLHGTDHDVVQD
RIEAGTFMVATAMTSGNVLIKDAIWEHNRPLISKLIEMGVTVIDEEDGIRVIADTSKLKP
VTVKTLPHPGFPTDMQAQFTALMSVVDGESTMIETVFENRFQHLEEMRRMGLQSEILRDT
AMIHGGKELQGAPVMSTDLRASAALILTGMVARGTTTVGKLVHLDRGYYKFHEKLAELGA
NIKRVSEA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggagttcgttttggataaaattattattgaaggtggtaatacacgtttgcaaggagaa
gtagtgattgaaggggctaaaaatgctgttcttccactcttggctgcaacaattttacct
gaggaaggaaagacaattttaaccaatgttccaatcctttcagatgtttttacgatgaat
aatgttgtccgtgggttaaatattcaagttgattttgatgaagctaacaataaaatcgaa
gtggatgcttctggtgatattttggatattgctccttacgagtatgttagtaagatgcgt
gcttcaatcgttgttttaggaccaattttagcacgtaatggacacgctaaggtttcaatg
cctggtggttgcacgattggtagccgcccaattgaccttcaccttaaaggtttggaagca
atgggagctaagattacgcaatctggtggtgatattacggcgactgttgatggtaaactt
aaaggaacaactatctatatggattttccgtctgttggagctacacaaaacttgatgatg
gctgcaactttagcagatggtgttaccactattgaaaatgtggcacgtgagccagagatt
gttgatttagcaatgcttcttaataaaatgggagcaaacgttagaggtgcaggtacagaa
acattaactattactggcgttgataatcttcatggtacagaccacgatgttgttcaagat
cgcattgaagcgggcacttttatggtggcaacagcaatgacatcaggaaatgttcttatc
aaggatgctatctgggagcacaaccgtccattgatttcaaagttgattgagatgggggtt
actgttattgatgaagaggacggtattcgtgtgattgctgatacatcaaaattgaaacct
gtaacagttaagacacttccccacccaggttttccaacagatatgcaggcacagttcaca
gcattaatgtcagttgtagatggtgaatcaacgatgattgaaacagtctttgagaaccgc
ttccaacatttagaagaaatgcgtcgtatgggcttgcaatcagaaattctacgagataca
gccatgattcatggaggtaaagaacttcaaggggcaccagtaatgtcaactgatcttcgt
gcaagtgctgctctgattttgacaggaatggttgctagaggaacaacaactgttgggaag
ttggttcaccttgatcgtgggtattataaattccatgaaaaattggctgagctaggtgca
aatattaaacgcgtaagtgaggcttaa

DBGET integrated database retrieval system